SecReT6
Protein ID: 330500929
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0015
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]20436..21767 [-]
Producthypothetical protein
NoteTssL
UniProt IDF4DV31
KEGG IDpmk:MDS_0015
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-72, Aligned region: 60..265
OmpA [PF00691], Evalue: 5.60E-16, Aligned region: 333..431
Protein Sequence: 443 a.a.     [Download]
>gi|330500929|ref|YP_004377798.1| unnamed protein product [Pseudomonas mendocina NK-01]
MTDQDDWLNKPPAAQPANNDRTQFMPRPGGRAPQAPAEAPAAPLQMPAAPLPAGQARGMNPLEQAAGPLL
SMLTRLRSTLAHPAPASLRAQLLGYLRQFEQRAEAAGVPRNDVLLARYALCTALDEAVLSTPWGSTSEWG
KQSLLITVHNEAWGGEKVFQLLEHCLQSPRERLDLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAA
TLRSVRGEREHELSPHWRGVNVAPDRLSRLLPPWVGLAVALALLLLVLLVLRMKLAADAEPVFRQIHALG
EVPVQSIEPAVVKPRVVERPRLATFLADDIRANRVAVEDGVDRSVVTIRGDELFSSGSASIRDDFQPLLL
RIAEAVAKVKGQVRITGHSDNQPIATLRFPSNWALSRARAEEVLQILAARTGQAERFSAEGLSDTEPLAS
NATAEGRAKNRRVEITVLAEGVE
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c21767-20436 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGACCGATCAAGACGACTGGCTGAACAAGCCGCCAGCAGCGCAACCGGCGAACAACGATCGCACCCAGT
TCATGCCGCGCCCGGGTGGTCGTGCTCCGCAGGCCCCAGCAGAGGCCCCGGCAGCACCGCTGCAGATGCC
GGCAGCGCCACTACCGGCGGGCCAGGCCCGCGGCATGAATCCGCTGGAGCAGGCCGCCGGGCCGCTGCTG
AGCATGCTCACCCGATTGCGCAGCACCTTGGCCCATCCCGCTCCAGCCAGCCTGCGCGCGCAGCTGCTGG
GTTACCTGCGCCAGTTCGAACAGCGCGCCGAGGCCGCCGGTGTGCCGCGCAACGACGTGTTGCTGGCGCG
CTATGCGCTGTGCACCGCCCTCGACGAGGCGGTGCTGAGCACGCCCTGGGGCAGCACCAGCGAGTGGGGC
AAGCAAAGCCTGCTGATCACCGTGCACAACGAGGCCTGGGGCGGCGAGAAGGTGTTCCAGCTGCTCGAAC
ACTGCCTGCAAAGCCCACGTGAACGGCTCGATCTGCTCGAACTGCTGTACCTGTGCACCAGCCTCGGCTT
CGAGGGTCGCTATCGGGTCATGCATGACGGTCGCAGCCAGCTGGAAGCGCTGCGCGAGCGCACCGCCGCG
ACCCTGCGCAGCGTGCGTGGCGAGCGCGAACACGAGCTGTCACCGCACTGGCGCGGGGTCAACGTGGCCC
CGGATCGCTTGTCACGACTGCTGCCGCCCTGGGTCGGCCTGGCCGTAGCTCTGGCGCTGTTGCTGCTGGT
GCTGCTGGTGTTGCGGATGAAACTGGCAGCCGATGCCGAACCGGTGTTCCGGCAGATTCACGCACTGGGC
GAAGTACCGGTGCAGAGCATCGAACCGGCCGTGGTGAAGCCGCGTGTAGTGGAGCGCCCGCGCCTGGCCA
CCTTCCTCGCCGACGACATCCGCGCCAACCGCGTAGCGGTCGAGGATGGCGTCGACCGCTCGGTGGTGAC
CATCCGCGGCGACGAGCTGTTCAGCTCCGGCAGCGCCAGCATCCGTGACGACTTCCAGCCGTTGCTGCTG
CGCATCGCCGAGGCTGTCGCCAAGGTCAAGGGCCAGGTGCGCATCACCGGCCACAGCGACAACCAGCCGA
TCGCCACGCTGCGCTTCCCCTCCAACTGGGCACTGTCGCGTGCCCGCGCCGAAGAGGTGCTGCAGATTCT
CGCAGCGCGCACCGGCCAGGCCGAGCGCTTCAGCGCCGAGGGCCTGAGCGACACCGAACCGCTGGCATCC
AATGCCACGGCCGAAGGACGGGCGAAGAATCGCCGGGTAGAGATCACCGTGCTGGCGGAGGGTGTGGAGT
GA
 Primer design