SecReT6
Protein ID: 330500930
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0016
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]21771..23105 [-]
Producthypothetical protein
NoteTssK
UniProt IDF4DV32
KEGG IDpmk:MDS_0016
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|330500930|ref|YP_004377799.1| unnamed protein product [Pseudomonas mendocina NK-01]
MSWNNRVIWSEGMFIGTQHFQQHDRYLEALIDARSRPLSAAGWGFAELQLDIGLLAQGKLAIVSARGLLP
DGTPFNIPQDDVAPEPLDIPDDLRDGVIYLALPLRRAGVRDTVEAGEALGGARYRGQVREVRDDNAAFES
RVPVMVGERALRLLTAADGLQEYAVLGVARVREKRADRALVLDEQYIPPLLDVAASAPLAAFRGELLGLL
HQRGEALAGRVVASSAGGASEIADFMLLQLVNRAQPLFAHLAQMQPLHPERLYSELLALAGEFATFSNAA
RRPLEFPPYIHDDLQASFTPVMQALREALSMLIDSKAVAIPIVEKAYGVHVAMLADRSLLDSASFILVVR
ADMPAETLRGRFGQQSKIGSVEHIRDLVNLQLPGINLLPLPVAPRQIPFHAGSTYYELDRGSEHWKQLAH
SGGFAFHVAGEYPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c23105-21771 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGTCCTGGAACAACCGTGTGATCTGGTCCGAAGGCATGTTCATCGGCACCCAGCATTTCCAGCAACATG
ATCGCTACCTGGAGGCTCTGATCGATGCCCGCAGCCGCCCACTGTCAGCCGCCGGCTGGGGTTTCGCCGA
GCTGCAGCTGGATATCGGCCTGCTGGCACAGGGCAAGCTGGCCATCGTCAGCGCCCGTGGCCTGTTGCCT
GACGGCACGCCGTTCAACATTCCCCAGGATGACGTGGCGCCGGAGCCGCTGGATATCCCCGACGACCTGC
GCGACGGCGTGATCTATCTGGCCCTGCCGCTGCGCCGGGCGGGTGTGCGAGACACCGTCGAAGCGGGTGA
AGCACTGGGCGGCGCGCGCTATCGCGGCCAGGTCCGCGAAGTGCGCGACGACAACGCAGCCTTCGAAAGC
CGTGTGCCGGTGATGGTTGGCGAACGCGCCCTGCGCCTGTTGACCGCCGCCGATGGCCTGCAGGAATACG
CCGTGTTGGGCGTAGCGCGCGTGCGCGAGAAACGCGCCGACCGCGCCCTGGTGCTGGACGAACAGTACAT
CCCGCCGCTGCTCGACGTAGCAGCCAGCGCGCCACTGGCTGCCTTTCGCGGCGAGCTGCTGGGCTTGCTG
CATCAGCGCGGCGAAGCCCTGGCCGGGCGCGTGGTGGCCTCCAGCGCTGGCGGCGCCTCGGAAATCGCCG
ACTTCATGCTGCTGCAACTGGTCAACCGCGCGCAGCCGCTGTTCGCCCACCTGGCGCAGATGCAGCCCCT
GCACCCGGAGCGCCTGTACAGCGAATTGCTGGCTCTGGCCGGCGAGTTCGCCACCTTCTCCAACGCCGCG
CGCCGGCCGCTGGAGTTCCCGCCCTACATCCACGATGACCTGCAGGCCAGCTTCACTCCGGTGATGCAGG
CACTGCGTGAAGCCTTGTCGATGCTGATCGACAGCAAGGCCGTAGCCATTCCCATCGTCGAGAAGGCCTA
CGGCGTGCACGTGGCCATGCTGGCTGACCGCAGCCTGCTGGACAGTGCCAGCTTCATCCTCGTGGTCCGC
GCCGACATGCCTGCCGAGACCCTGCGCGGGCGCTTCGGCCAGCAGAGCAAGATCGGCTCGGTGGAGCACA
TCCGCGATCTGGTCAACCTGCAGCTACCGGGCATCAACCTGCTGCCGCTGCCGGTGGCCCCACGGCAGAT
TCCGTTCCACGCCGGCTCGACCTACTACGAGCTCGACCGTGGCAGCGAACACTGGAAGCAGCTGGCGCAC
TCCGGCGGCTTCGCTTTCCACGTGGCGGGCGAATACCCCGGCCTGAACCTGGCCTTCTGGGCGATACGGG
GCTAA
 Primer design