SecReT6
Protein ID: 330500931
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0017
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]23117..23641 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF4DV33
KEGG IDpmk:MDS_0017
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-35, Aligned region: 21..158
Protein Sequence: 174 a.a.     [Download]
>gi|330500931|ref|YP_004377800.1| unnamed protein product [Pseudomonas mendocina NK-01]
MNNVRQRLLRPALLGLVLAGLGSGCSKDAMDGSAATQESTSVVLQLQAGDELNPTVEGYSAPVRVRLLEL
RSAAAFSRTDYFSLAERAAATLGGELVAEDEWLVHPGQTRELKRTLAPETRHLGLLVGYREIDRAQWRVV
LEPKQGTRSHYRIDLGTHAASAAELAAPSRLDSR
 
Nucleotide Sequence: 525 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c23641-23117 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGAACAACGTGCGACAACGACTTCTTCGGCCCGCTCTGCTGGGCCTGGTGCTGGCAGGGCTGGGCAGCG
GCTGTAGCAAGGATGCGATGGACGGCAGCGCCGCCACGCAAGAATCGACCAGCGTCGTGCTGCAGCTGCA
GGCAGGCGATGAGCTGAACCCTACCGTCGAAGGCTACAGCGCCCCGGTGCGTGTGCGCCTGCTGGAGCTG
CGCAGCGCCGCCGCATTCAGCCGGACCGACTACTTCAGCCTCGCCGAGCGCGCGGCTGCGACCCTGGGCG
GCGAGCTGGTGGCCGAGGACGAATGGCTGGTCCATCCCGGCCAGACCCGGGAACTGAAACGCACGCTCGC
CCCGGAAACGCGTCATCTCGGCCTGCTGGTCGGCTACCGCGAAATTGACCGGGCGCAGTGGCGCGTGGTC
CTGGAGCCGAAGCAGGGCACCCGCAGCCATTACCGCATCGACCTCGGGACCCACGCCGCCAGCGCCGCTG
AGCTCGCCGCGCCGTCCCGCCTCGACTCTCGCTAA
 Primer design