SecReT6
Protein ID: 330500932
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0018
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]23656..25065 [-]
Producthypothetical protein
NoteFha
UniProt IDF4DV34
KEGG IDpmk:MDS_0018
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-14, Aligned region: 30..97
Protein Sequence: 469 a.a.     [Download]
>gi|330500932|ref|YP_004377801.1| unnamed protein product [Pseudomonas mendocina NK-01]
MALRLTITSYHKITPGQCPEKTLEHGVMAIGRSPDNDWVLPDPARLVSSKHCLVQNKDGRYYITDNSTNG
VELVKAGIRMQRGNSELLQHGEVIRIGEYEIAVALESSIAEGTGPFSSVSSASSFEALMANQQAAPSSPF
EAPANPFDASASAHLQSVAPHETLPDLFDFLGPNTAAPAPVADHVPAQQHDFRPPEFKTPTPAVEPKPTS
APGLIPDDWNLFDDIAPTTAPAAPMPAPSPRPEPIEPAPMPAPVAVPAAPITTPPMQAQAVQQGDALLQA
FLRGAGLDRLRLDDQQAAAQMESIGRSYRLMVEGLIDVLRARSSLKGEFRLQQTMVQPVENNPLKFAPNA
EEALLLLLRGGNSAFMPADQAVQDGFEDLRAHQLAVMAGVQAAIRHLLARFEPQALEARMGKGGGLASLL
PGSRQAQCWQQFVELYATLSREAEDDFQDLFGREFGRAYEQHIARQRRP
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c25065-23656 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGCGCTGCGCTTGACCATCACCAGCTATCACAAGATCACACCAGGCCAATGTCCCGAGAAAACCTTGG
AACATGGCGTGATGGCAATTGGCCGCAGCCCGGATAATGACTGGGTATTACCTGATCCGGCACGTCTGGT
CTCGTCCAAACATTGCCTCGTGCAAAACAAGGATGGCCGCTACTACATCACCGACAACAGCACCAATGGC
GTCGAACTGGTCAAGGCCGGTATACGCATGCAACGCGGAAACAGTGAACTTCTGCAGCACGGCGAAGTTA
TCCGGATTGGCGAGTACGAAATTGCAGTAGCGCTGGAAAGTTCCATCGCGGAAGGCACCGGGCCGTTTTC
CAGTGTCTCGTCCGCAAGCAGTTTCGAAGCGCTGATGGCCAACCAGCAGGCCGCTCCAAGCAGCCCTTTC
GAAGCGCCGGCCAACCCCTTCGATGCCTCGGCCAGCGCCCACCTGCAAAGCGTCGCCCCGCACGAAACGT
TGCCCGATCTGTTCGATTTTCTCGGCCCGAACACGGCAGCGCCGGCGCCCGTTGCCGACCACGTACCGGC
GCAGCAGCATGACTTCCGGCCACCGGAGTTCAAGACGCCTACCCCAGCAGTCGAACCCAAACCAACCAGC
GCGCCGGGCCTGATTCCCGATGATTGGAACCTGTTCGACGACATCGCGCCGACCACCGCTCCAGCAGCGC
CGATGCCGGCCCCTTCCCCTCGACCGGAGCCCATCGAGCCGGCACCTATGCCAGCCCCGGTTGCCGTACC
AGCCGCACCGATTACGACGCCCCCCATGCAGGCGCAGGCAGTTCAACAAGGGGATGCGCTGCTGCAGGCC
TTCCTGCGCGGCGCCGGGCTCGATCGCCTGCGCCTGGATGACCAGCAGGCAGCCGCTCAGATGGAAAGCA
TCGGGCGCAGTTACCGCCTGATGGTCGAGGGCCTGATCGATGTACTGCGGGCGCGCAGCAGCCTCAAGGG
CGAGTTCCGCCTGCAGCAGACCATGGTTCAGCCGGTGGAAAACAACCCGCTGAAGTTCGCGCCCAACGCC
GAAGAAGCCCTGCTCCTGCTGCTGCGTGGCGGTAACTCGGCGTTCATGCCGGCGGACCAGGCCGTGCAGG
ACGGTTTCGAGGACCTGCGCGCCCATCAACTGGCCGTCATGGCGGGTGTACAGGCTGCCATCCGTCACCT
GCTGGCGCGTTTCGAACCGCAGGCACTGGAAGCACGCATGGGCAAGGGAGGTGGGCTGGCCAGCCTGCTG
CCGGGCTCGCGCCAGGCTCAGTGCTGGCAGCAGTTCGTGGAGCTGTACGCGACCTTGTCGCGCGAAGCCG
AAGACGATTTTCAGGACCTGTTCGGCCGCGAGTTCGGCCGGGCCTATGAGCAACATATCGCCCGTCAACG
ACGCCCCTGA
 Primer design