SecReT6
Protein ID: 330500933
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0019
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]25446..26465 [+]
Producthypothetical protein
NoteTssA
UniProt IDF4DV35
KEGG IDpmk:MDS_0019
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-20, Aligned region: 53..112
Protein Sequence: 339 a.a.     [Download]
>gi|330500933|ref|YP_004377802.1| unnamed protein product [Pseudomonas mendocina NK-01]
METSLLLAAVSDASPCGEDLEYDSDFLQLERDALGRPERSMGDAIQAAEPPEWRQLEQACHGLLQRSKDL
RITHYLLQSRLALRGVEGLADSLELILELLSRYWPEIHPQLDADDDNDPTVRINTLSGLTCETNLGLLRN
AVLVRSRVFGNITLRAALNAAGLHPASSESLSVEELGGALQDADSESLQLTRDALGRALQSLDAIERLVS
EQVGSAQGVELSALQQPLKLALQVLGDSPAGANADNHPADTSAPAEASMQPASAPAAMRVSGEIANRDDV
LKSLERILTYYARHEPSSPLPVLLNRARSLVNADFATIVRNLIPDGMSQFENLRGPDEY
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|330500914|ref|NC_015410.1|:25446-26465 Pseudomonas mendocina NK-01 chromosome, complete genome
GTGGAGACTTCGTTGTTGCTCGCCGCCGTTTCGGATGCTTCGCCCTGCGGTGAAGATCTGGAATACGACA
GCGACTTTCTCCAGCTCGAGCGCGATGCCTTGGGGCGCCCCGAGCGCAGCATGGGCGACGCTATCCAGGC
CGCCGAACCGCCGGAATGGCGCCAGTTGGAACAGGCCTGCCACGGCCTTCTGCAGCGCAGCAAGGATTTG
CGCATCACCCATTACCTGCTGCAGAGCCGCCTGGCGTTGCGCGGTGTCGAAGGGCTGGCAGACAGCCTCG
AATTGATCCTCGAACTGCTCTCGCGCTATTGGCCCGAGATCCACCCGCAGCTCGATGCCGACGACGACAA
CGATCCCACCGTTCGCATCAACACCCTCTCCGGCCTCACCTGCGAGACCAACCTCGGCCTGCTGCGCAAT
GCCGTGCTGGTGCGTTCGCGGGTGTTCGGCAATATCACCCTGCGCGCAGCGCTGAACGCTGCCGGTTTGC
ACCCGGCCAGCAGCGAAAGCCTCAGCGTCGAAGAGCTCGGCGGCGCGTTGCAGGATGCCGACAGCGAATC
CCTGCAGCTCACTCGCGATGCCCTCGGCCGCGCGTTGCAGAGCCTGGATGCGATCGAACGACTGGTCAGC
GAACAGGTCGGTTCCGCTCAGGGTGTGGAACTGTCGGCTTTGCAGCAACCGCTCAAGCTGGCCTTGCAGG
TTCTCGGTGACAGCCCTGCCGGGGCCAACGCCGACAATCATCCAGCAGACACGTCAGCGCCTGCCGAGGC
TTCGATGCAGCCGGCGTCAGCACCTGCCGCGATGCGTGTCAGTGGCGAAATCGCCAATCGCGACGACGTG
CTCAAGAGCCTGGAGCGGATCCTCACCTACTACGCCCGCCACGAGCCTTCCAGCCCGTTGCCGGTGCTGC
TCAACCGGGCTCGCAGCCTGGTCAACGCCGACTTCGCGACCATCGTGCGCAACCTCATACCCGATGGCAT
GAGCCAGTTCGAAAACCTGCGCGGCCCCGACGAGTACTAG
 Primer design