SecReT6
Protein ID: 330500934
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0020
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]26557..27072 [+]
Producthypothetical protein
NoteTssB
UniProt IDF4DV36
KEGG IDpmk:MDS_0020
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-61, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|330500934|ref|YP_004377803.1| unnamed protein product [Pseudomonas mendocina NK-01]
MANSSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMSDLTGKPAEPLPAVADRKFLEIDVDNFD
SRLKAMKPRVAFNVPNELTGEGNLSIDMTFQSMDDFSPAAVARQVDALNQLLEARTQLANLLTYMDGKTG
AEDVIMKAIKDPALLQALASAPKPQDNEPQA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|330500914|ref|NC_015410.1|:26557-27072 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGCGAACAGCAGTTCTCAGAAATTCATCGCGCGCAACCGCGCGCCCCGTGTGCAGATCGAATACGACG
TCGAACTCTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGTCCGACCTCACCGG
CAAGCCGGCCGAGCCGCTGCCGGCGGTGGCCGATCGCAAGTTCCTGGAAATCGATGTCGACAACTTCGAC
TCGCGCCTCAAGGCGATGAAGCCGCGTGTGGCGTTCAACGTGCCCAACGAGCTGACCGGCGAAGGCAATC
TGAGCATCGACATGACCTTCCAGAGCATGGATGACTTCAGCCCGGCCGCCGTGGCGCGCCAGGTAGACGC
CCTCAACCAACTGCTGGAGGCCCGCACTCAGCTGGCTAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCCGAGGACGTGATCATGAAGGCGATCAAGGACCCGGCACTGCTGCAGGCCCTGGCCAGCGCGCCGAAAC
CCCAGGACAACGAGCCCCAGGCCTGA
 Primer design