SecReT6
Protein ID: 330500935
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0021
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]27087..28580 [+]
Producthypothetical protein
NoteTssC
UniProt IDF4DV37
KEGG IDpmk:MDS_0021
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.10E-195, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.0037, Aligned region: 18..78
Protein Sequence: 497 a.a.     [Download]
>gi|330500935|ref|YP_004377804.1| unnamed protein product [Pseudomonas mendocina NK-01]
MSEQLQQDQAALASTEQTSEFASLLMQEFKPKTERAKEAVETAVRTLAEQALAQTDLISNDAIKSIESII
AAIDAKLTAQVNQIIHHSDFQQVESAWRGLHYLVNNTESDEQLKIRVLNISKPELHKTLKKFKGTAWDQS
PVFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHAPFISAASPTVMGMGSWQELS
NPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWAN
AAYAMAVNINRSFKHYGWCSRIRGVESGGEVPNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKERDEM
QLWLQDWILKYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRLVSK
LPSAKGA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|330500914|ref|NC_015410.1|:27087-28580 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGAGCGAACAGTTGCAACAAGACCAGGCCGCACTGGCCAGCACCGAGCAGACCAGCGAATTTGCCTCGC
TGCTGATGCAGGAATTCAAACCCAAGACCGAACGTGCCAAGGAAGCGGTGGAGACTGCCGTGCGTACCCT
GGCCGAGCAGGCGCTGGCGCAAACCGATCTGATCTCCAACGATGCGATCAAGTCGATCGAGTCGATCATC
GCCGCCATCGACGCCAAGCTCACCGCGCAGGTCAACCAGATCATCCACCACAGCGACTTTCAGCAGGTGG
AAAGCGCCTGGCGTGGTCTGCACTACCTGGTGAACAACACCGAGAGCGACGAGCAGCTGAAGATTCGCGT
GCTCAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCCTGGGACCAGAGC
CCGGTGTTCAAGAAACTCTACGAAGAGGAATACGGCCAGTTCGGTGGCGAGCCCTACGGCTGCCTGGTCG
GCGATTACTACTTCGATCAGTCGCCGCCCGATGTCGAGTTGCTCGGTGAGCTGTCCAAGGTCTGCGCGGC
GATGCACGCGCCGTTCATTTCCGCGGCCTCGCCGACAGTGATGGGCATGGGCTCCTGGCAGGAACTGTCC
AACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCTGGCTGGCGCTCGCTACGCGAGTCCG
AGGATTCGCGTTACATCGGCCTGACCATGCCGCGTTTCCTGGCCCGCCTGCCATATGGCGCCAAGACCGA
TCCGGTAGAAGCCTTCGCCTTCGAGGAAAACACCGACGGCGCCGACAGCAGCAAGTACACCTGGGCCAAC
GCTGCCTATGCCATGGCGGTGAACATCAACCGTTCGTTCAAGCACTACGGCTGGTGCTCGCGCATTCGTG
GCGTCGAGTCCGGTGGCGAGGTACCGAACCTGCCGGCGCACACCTTCCCCACCGATGATGGTGGCGTGGA
CATGAAGTGCCCCACCGAGATCGCCATTTCCGACCGTCGCGAGGCCGAGCTGGCGAAGAATGGCTTCATG
CCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGTGCGCAGTCGCTGCAGAAACCGGCCG
AGTACGACGATCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGCCACCTG
CCGCTTCGCGCATTACCTCAAGTGCATCGTTCGCGACAAGATCGGCTCGTTCAAGGAGCGCGACGAGATG
CAGCTGTGGCTGCAGGACTGGATCCTCAAGTACGTCGACGGTGACCCCGCTCACTCCACCGAGACCACCA
AGGCGCAGCACCCACTCGCTGCTGCAGAAGTCGTGGTGGAAGAGGTGGAGGGCAACCCGGGTTACTACAA
CTCGAAGTTCTACCTGCGTCCGCACTATCAGCTCGAAGGGCTGACGGTGTCGCTGCGGCTGGTTTCCAAA
CTGCCGTCGGCCAAGGGCGCATAA
 Primer design