SecReT6
Protein ID: 330500936
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0022
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]28721..29209 [+]
Producthypothetical protein
NoteTssD
UniProt IDF4DV38
KEGG IDpmk:MDS_0022
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-47, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|330500936|ref|YP_004377805.1| unnamed protein product [Pseudomonas mendocina NK-01]
MAVDIFIKIGDIKGESQDKTHKDEIEVLNWSWGMSQSGNMHTGTGGGAGKVSIQDLSLTKYVDKATPNLM
MHCSSGKHVPKVTLTVRKAGGDSQVEYLIINLEEVLISSLSTGGSGNDDRLIENVTLNFAKVTVDYQPQK
ADGTKEGGPIKYGWNIRSNVKI
 
Nucleotide Sequence: 489 bp     [Download]
>gi|330500914|ref|NC_015410.1|:28721-29209 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGCTGTTGATATCTTCATCAAGATCGGTGACATCAAGGGCGAGTCCCAGGACAAGACCCACAAGGACG
AAATCGAAGTGCTCAACTGGAGCTGGGGCATGTCCCAGTCCGGCAATATGCACACCGGCACCGGTGGCGG
CGCGGGCAAGGTGAGCATCCAGGACCTGTCGCTGACCAAGTACGTCGACAAGGCTACCCCCAACCTGATG
ATGCATTGCTCCAGCGGCAAGCACGTGCCCAAGGTCACCCTGACCGTGCGCAAGGCAGGCGGTGATTCCC
AGGTCGAGTACCTGATCATCAACCTCGAAGAAGTGCTGATCTCCTCGCTGAGCACTGGCGGTTCGGGCAA
CGACGACCGCCTGATCGAGAACGTGACCCTGAACTTCGCCAAAGTCACGGTCGACTACCAGCCGCAGAAA
GCCGACGGCACCAAGGAAGGCGGCCCGATCAAGTACGGCTGGAACATCCGTTCCAACGTCAAGATCTGA
 Primer design