SecReT6
Protein ID: 330500939
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0025
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]30203..30718 [+]
Producthypothetical protein
NoteTssE
UniProt IDF4DV41
KEGG IDpmk:MDS_0025
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-21, Aligned region: 37..145
Protein Sequence: 171 a.a.     [Download]
>gi|330500939|ref|YP_004377808.1| unnamed protein product [Pseudomonas mendocina NK-01]
MTSPMTPRERLQPSLLDRLTDDDPGNPQESADRRVLSLNQLKASVLRDLTWLFNTIALLDADTTRHTPAG
TSVINYGLPALAGSSVSGIDVAALESLIQRAILTFEPRILAHSLRVRAHVGHEQMNHNALSFEIQGDLWA
QPAPLPLLLRTELDLESGHVQVLPAEQRRRS
 
Nucleotide Sequence: 516 bp     [Download]
>gi|330500914|ref|NC_015410.1|:30203-30718 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGACCAGCCCCATGACCCCGCGTGAGCGCCTGCAGCCTTCGCTGCTCGACCGCCTGACCGACGATGATC
CCGGCAATCCGCAGGAAAGCGCGGATCGTCGCGTGCTCTCGCTTAACCAGCTCAAGGCCTCGGTGTTGCG
TGATCTGACCTGGCTGTTCAACACCATCGCCCTGCTCGATGCCGACACCACTCGGCACACGCCAGCCGGC
ACCTCGGTGATCAACTATGGGCTGCCGGCACTGGCCGGCAGCAGCGTGTCCGGTATCGACGTCGCCGCCC
TGGAGAGTCTGATCCAACGCGCCATTCTCACCTTCGAGCCACGCATCCTCGCCCATAGCCTGCGGGTGCG
GGCGCACGTGGGTCATGAGCAGATGAATCACAACGCCCTGAGCTTCGAAATCCAGGGTGACCTGTGGGCC
CAGCCCGCGCCCCTGCCCTTGCTGCTGCGCACCGAGCTGGACCTGGAGTCCGGCCATGTGCAGGTGCTGC
CCGCCGAGCAGCGGAGACGCTCATGA
 Primer design