SecReT6
Protein ID: 330500940
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0026
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]30715..32574 [+]
Producthypothetical protein
NoteTssF
UniProt IDF4DV42
KEGG IDpmk:MDS_0026
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.00E-219, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|330500940|ref|YP_004377809.1| unnamed protein product [Pseudomonas mendocina NK-01]
MNPRLLELYNQELQHIRDGAAEFAREYPKIASRLSLSGLECTDPYVERLLEGFAWLTARVQLKLDAEYPV
FTHNLLEIAYPHYLAPTPSMTVVQLHTDANDGALNGSFNLPRDSVLRATLGKDSQTPCEYRTAHPVTLWP
LQVAEAEYISNPSAALGRLAASEPRAKAALRITLRSGAEIPFASLDLDNLPLYLSGLDELPFRLYEQLLG
NRVAVFARQPGRDWVERLPTDALRPCGFDDAEAALPVVPQAFQGYRLLQEYFALPQRFLFVDFCNLRRAV
RQCSGNELELIVLFDRLDSNLQNQVDASQFLPFCTPAINLFPRRLDRIHLSDKVHEHHAIADRTRPMDFE
IHSLRGVTGHGSGPEQTFLPFYAVRDPARYGRDQAYYIVRREPRVLSAGQRRNGTRSSYVGSETFISLVD
SHQAPYRHDLRQLGLSALCTNRDLPLFMTVGSGKSDFTLADSAPVQSVRCVAGPSRPRASPAHDNQAWRL
ISQLSLNYLSLAEQGQGAAALREMLRLYGDIQNPALQLQIEGLRDVSAKPCTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSLNSFTETVLRSTERGEIMRWKARPGRRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|330500914|ref|NC_015410.1|:30715-32574 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGAACCCCCGTTTGCTGGAGTTGTACAACCAGGAGCTGCAACACATCCGCGACGGCGCGGCCGAGTTCG
CCCGCGAGTACCCGAAGATCGCCAGCCGCCTCAGCCTGTCCGGCCTGGAGTGCACCGACCCCTACGTCGA
GCGCCTGCTCGAAGGCTTCGCCTGGCTGACTGCGCGAGTACAGCTCAAGCTCGACGCCGAGTACCCGGTA
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACGCCGTCGATGACCGTGGTGC
AGTTGCATACCGATGCCAACGATGGCGCGCTCAACGGCAGCTTCAACCTGCCTCGCGACAGCGTGTTGCG
CGCCACCCTCGGCAAGGACAGCCAGACCCCCTGCGAATACCGCACGGCTCACCCGGTAACCTTGTGGCCG
CTACAGGTGGCGGAGGCCGAGTACATAAGCAACCCTTCCGCCGCGCTGGGTCGCCTGGCCGCCAGCGAGC
CGCGTGCCAAAGCTGCGCTGCGCATCACCCTGCGCAGTGGCGCTGAAATACCCTTCGCCAGCCTGGATCT
GGACAACCTGCCGCTGTACCTCAGCGGCCTCGACGAGCTGCCATTTCGTCTGTACGAGCAACTGCTGGGT
AACCGCGTCGCGGTGTTCGCCCGCCAGCCAGGGCGCGACTGGGTCGAACGCCTGCCGACCGACGCCTTGC
GCCCGTGCGGTTTCGATGATGCCGAGGCGGCCCTGCCGGTGGTGCCGCAGGCCTTCCAGGGCTATCGCCT
GCTGCAGGAGTATTTCGCCCTGCCGCAGCGTTTTCTGTTCGTCGACTTCTGCAATCTGCGCCGTGCCGTG
CGCCAGTGCAGCGGCAACGAGCTGGAGTTGATCGTGCTGTTCGATCGCCTCGACAGCAACCTGCAGAATC
AGGTAGATGCCAGCCAGTTCCTGCCGTTCTGCACTCCGGCGATCAACCTGTTTCCGCGGCGCCTGGATCG
CATCCACCTGAGCGACAAGGTGCACGAGCACCACGCCATTGCCGACCGCACACGGCCGATGGATTTCGAG
ATCCATTCGTTGCGCGGCGTCACCGGCCATGGCAGTGGCCCGGAGCAGACCTTCCTGCCCTTCTATGCCG
TGCGTGACCCCGCGCGTTATGGGCGCGATCAGGCCTACTACATCGTGCGCCGCGAACCGCGTGTACTGTC
GGCCGGGCAGCGCCGCAACGGCACGCGCTCCAGCTACGTGGGCAGCGAAACCTTCATCAGCCTGGTCGAC
AGCCACCAGGCGCCGTATCGCCATGACCTGCGCCAGCTCGGCCTCAGCGCCCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGACCGTCGGCAGCGGCAAGAGCGACTTTACCCTGGCCGACAGCGCGCCGGTGCAGAG
CGTGCGCTGTGTGGCCGGGCCGAGCCGGCCGCGTGCCAGCCCGGCCCATGACAACCAGGCCTGGCGCTTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGCTGGCCGAGCAGGGCCAGGGCGCCGCTGCCCTGCGCGAGA
TGCTGCGCCTGTATGGCGACATACAGAATCCGGCGCTGCAACTGCAGATCGAAGGCCTGCGCGACGTCAG
CGCTAAACCCTGTACGCGGCGTTTGCCAATGCCCGGGCCAATCGTCTTTGGGCGTGGTCTGGAAATCACC
CTGGAATTCGACGAGAACGCCTTCCGCGGTACCGGGGTGTTTCTCCTCGGCGCGGTGTTCGAGCGTTTCC
TGGCGCGTTACGTATCCCTCAACAGCTTTACCGAGACGGTGCTGCGCAGCACCGAGCGCGGCGAGATCAT
GCGATGGAAAGCCCGGCCCGGCCGTCGTCCGAACCTCTAG
 Primer design