SecReT6
Protein ID: 330500941
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0027
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]32538..33590 [+]
Producthypothetical protein
NoteTssG
UniProt IDF4DV43
KEGG IDpmk:MDS_0027
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.30E-113, Aligned region: 19..320
Protein Sequence: 350 a.a.     [Download]
>gi|330500941|ref|YP_004377810.1| unnamed protein product [Pseudomonas mendocina NK-01]
MESPARPSSEPLDTLAQMQAQPWEYDFFQALRRIENEHPHLPRLGRSRRLADDPLRLGQRQEGTFAPATL
AAVTPAGDQRPARLEQYFFGLGGPNGPLPLHLTEYVRERQRNHADSTSKHFLDLFHHRLLSLFYRAWAEA
RPTVSHDRPDDDYWSARLAAFSGRGMPSLRRPGLLDDAAKLHYSGHLAAQTRYPDGLKAILADYFGVPVQ
IEEYAGSWLSLPERTRLGVESSQLGVDFCLGSQVWDRQHSFRICFGPLTLDQYNAMLPDGESFAALVAWV
AEYQGDELDWQLNLVLQREEVPALRLNGQARLGYTTWLGQPQHDARDLVLARHHAAATSPADQSRRTPHG
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|330500914|ref|NC_015410.1|:32538-33590 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGAAAGCCCGGCCCGGCCGTCGTCCGAACCTCTAGACACGCTTGCGCAGATGCAGGCGCAGCCCTGGG
AGTACGACTTCTTCCAGGCCCTGCGACGCATCGAGAACGAGCACCCGCACCTGCCGCGCCTGGGCCGTTC
CCGGCGCCTGGCAGACGATCCGCTGCGCCTCGGCCAGCGCCAGGAAGGCACGTTCGCTCCAGCCACGCTG
GCCGCTGTAACGCCCGCCGGCGACCAGCGTCCGGCACGCCTGGAGCAGTATTTCTTCGGCCTCGGCGGGC
CCAACGGACCGCTGCCGCTGCACCTGACCGAGTACGTGCGCGAGCGTCAGCGCAACCACGCCGACAGCAC
CAGCAAGCACTTCCTCGACCTGTTTCATCATCGCCTGCTGAGCCTGTTCTATCGTGCCTGGGCCGAAGCG
CGGCCGACCGTCAGCCATGACCGCCCGGATGACGACTACTGGTCGGCGCGCCTGGCCGCCTTCAGTGGTC
GCGGCATGCCCAGCCTGCGCCGGCCGGGCCTGCTGGATGATGCGGCGAAGCTTCACTACAGCGGTCACCT
GGCCGCGCAGACGCGTTACCCCGATGGCCTCAAGGCGATCCTTGCCGACTACTTCGGGGTGCCGGTGCAG
ATCGAGGAATACGCCGGCAGCTGGCTCAGCCTGCCCGAGCGCACGCGCCTGGGCGTGGAGTCCAGCCAAC
TTGGCGTGGACTTCTGCCTGGGCAGCCAGGTCTGGGATCGCCAGCACAGCTTCCGTATCTGCTTCGGCCC
GCTGACGCTCGATCAGTACAACGCCATGCTGCCCGATGGCGAGTCGTTCGCCGCGCTGGTGGCCTGGGTC
GCCGAATACCAGGGCGACGAGCTGGACTGGCAACTGAATCTCGTATTGCAGCGCGAGGAAGTCCCCGCGC
TGCGTCTCAACGGCCAGGCTCGCCTGGGCTACACCACCTGGCTTGGTCAGCCACAGCACGACGCCAGGGA
TCTGGTGCTGGCCCGCCATCACGCCGCAGCAACTTCGCCGGCGGATCAATCAAGGAGAACTCCACATGGG
TGA
 Primer design