SecReT6
Protein ID: 330500942
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0028
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]33583..36255 [+]
Productchaperone
NoteTssH
UniProt IDF4DV44
KEGG IDpmk:MDS_0028
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.70E-39, Aligned region: 619..785
AAA [PF00004], Evalue: 3.90E-18, Aligned region: 233..366
AAA [PF00004], Evalue: 3.90E-18, Aligned region: 625..709
ClpB_D2-small [PF10431], Evalue: 2.80E-13, Aligned region: 792..865
AAA_5 [PF07728], Evalue: 2.40E-12, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 2.40E-12, Aligned region: 337..363
AAA_5 [PF07728], Evalue: 2.40E-12, Aligned region: 624..742
AAA_16 [PF13191], Evalue: 2.80E-11, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 2.80E-11, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 2.80E-11, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 2.80E-11, Aligned region: 423..538
AAA_16 [PF13191], Evalue: 2.80E-11, Aligned region: 595..669
Sigma54_activat [PF00158], Evalue: 7.90E-07, Aligned region: 212..247
Sigma54_activat [PF00158], Evalue: 7.90E-07, Aligned region: 623..745
AAA_22 [PF13401], Evalue: 9.20E-07, Aligned region: 63..96
AAA_22 [PF13401], Evalue: 9.20E-07, Aligned region: 232..314
AAA_22 [PF13401], Evalue: 9.20E-07, Aligned region: 357..398
AAA_22 [PF13401], Evalue: 9.20E-07, Aligned region: 622..647
AAA_22 [PF13401], Evalue: 9.20E-07, Aligned region: 686..708
AAA_25 [PF13481], Evalue: 2.30E-06, Aligned region: 227..310
AAA_25 [PF13481], Evalue: 2.30E-06, Aligned region: 622..652
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 233..340
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 625..652
AAA_19 [PF13245], Evalue: 3.60E-05, Aligned region: 233..255
AAA_19 [PF13245], Evalue: 3.60E-05, Aligned region: 622..646
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 211..249
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 284..317
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 624..641
Zeta_toxin [PF06414], Evalue: 0.00027, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00027, Aligned region: 619..664
AAA_18 [PF13238], Evalue: 0.00037, Aligned region: 233..250
AAA_18 [PF13238], Evalue: 0.00037, Aligned region: 626..653
AAA_17 [PF13207], Evalue: 0.0004, Aligned region: 233..252
AAA_17 [PF13207], Evalue: 0.0004, Aligned region: 624..660
AAA_14 [PF13173], Evalue: 0.00058, Aligned region: 233..323
AAA_14 [PF13173], Evalue: 0.00058, Aligned region: 623..705
Clp_N [PF02861], Evalue: 0.00064, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00064, Aligned region: 110..148
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 216..251
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 624..644
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 225..248
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 622..649
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 233..244
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 622..643
Hpr_kinase_C [PF07475], Evalue: 0.0069, Aligned region: 709..726
Protein Sequence: 890 a.a.     [Download]
>gi|330500942|ref|YP_004377811.1| unnamed protein product [Pseudomonas mendocina NK-01]
MGEISRTALFGKLNSVGYKAIEAATVFCKLRGNPYVELAHWLHQLLQLQDSDLHRIIRQFSLEPARLARD
LTDALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGEHQVRTGYLIIGILKTPSLRQVLLGLSGEFAK
IKVETLSERFDEYVGDSPENNLAANDGFAAAAPGEASGAMAPAAMGKQEALKRFTIDLTEQARKGELDPI
VGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIAAGDVPPSLKDVELRSLDVGLLQAGAS
MKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGSLRTVAATTWAEYK
KHIEKDPALTRRFQVVQVPEPSEDKALLMMRGVASTMEKHHQVQILDEALDAAVKLSHRYIPARQLPDKS
VSLLDTACARVAISLHAVPAEIDDSRRRIEALETELQIIAREHAIGIDVSLRQANSESLLAAERERLAEL
ESRWAEEKQLVDELLATRASLRESAGVVDQDSGTDHQALRARLVELQQRLSQLQGEAPLILPTVDYQAVA
SVVADWTGIPVGRMARNEVETVLNLDSLLGKRIIGQDHALKMIAKRIQTSRAGLDNPNKPIGVFMLAGTS
GVGKTETALALAEALYGGEQNLITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLD
EVEKAHPDVHEIFFQVFDKGVMEDGEGRLIDFKNTLILLTTNAGTEQVARLCQDADNLPDPESIARDLRQ
PLLEIFPPALLGRLVTIPYYPLSDTMLKAITRLQLGRIKKRIESTHKVPFDYDEAVVDLVVSRCTESESG
GRQIDAILTNGMLPDMSREFLTRMMEGKPLAGVRVSVADNDLNYSFADNA
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|330500914|ref|NC_015410.1|:33583-36255 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGGTGAAATCAGTCGTACCGCGCTGTTCGGCAAGCTCAACAGCGTCGGCTACAAGGCCATCGAGGCCG
CCACCGTGTTCTGCAAGCTGCGCGGCAATCCCTACGTCGAGTTGGCGCACTGGTTGCACCAGCTCCTGCA
ACTGCAGGACTCCGACCTGCACCGCATCATCCGCCAGTTCAGCCTGGAGCCGGCGCGCCTGGCGCGTGAC
CTGACCGACGCACTCGACCGCCTGCCGCGCGGCTCGACCTCGATCACCGACCTGTCCTCGCACGTCGAGG
AAGCGGTCGAGCGTGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAGCACCAGGTGCGCACCGGCTACCT
GATCATCGGCATCCTCAAGACGCCGAGCCTGCGCCAGGTGCTGCTGGGCCTGTCGGGCGAGTTCGCCAAG
ATCAAGGTGGAGACCCTCAGCGAGCGCTTCGACGAATACGTCGGCGATTCGCCGGAGAACAACCTGGCCG
CCAACGACGGTTTCGCCGCCGCTGCCCCGGGCGAGGCCAGTGGCGCCATGGCGCCAGCGGCGATGGGCAA
GCAGGAGGCGCTCAAGCGCTTCACCATCGACCTCACCGAGCAGGCGCGCAAGGGCGAGCTGGACCCCATC
GTCGGCCGCGATGAGGAGATCCGCCAACTGGTCGACATCCTCATGCGCCGCCGCCAGAACAACCCGATCC
TCACCGGTGAAGCCGGCGTCGGCAAGACCGCCGTGGTCGAGGGTTTCGCCCTGCGCATCGCCGCCGGTGA
CGTGCCGCCCTCGCTCAAGGATGTGGAGCTGCGCAGCCTGGATGTCGGCCTGCTGCAGGCCGGCGCCAGC
ATGAAAGGCGAGTTCGAGCAGCGCCTGCGTCAGGTCATCGAAGACGTGCAGGCCTCGCCCAAGCCGATCA
TCCTGTTCATCGACGAAGCCCACACCCTGGTCGGCGCTGGTGGTGCGGCCGGTACTGGCGACGCGGCCAA
CCTGCTCAAGCCGGCGCTGGCGCGCGGCAGCCTACGCACCGTCGCCGCCACTACCTGGGCCGAGTACAAG
AAGCATATCGAGAAGGACCCGGCGCTGACTCGTCGCTTCCAGGTGGTGCAGGTGCCCGAGCCGTCCGAGG
ACAAGGCGCTGTTGATGATGCGCGGCGTGGCCTCGACCATGGAGAAACACCACCAGGTGCAGATTCTCGA
CGAGGCCCTGGACGCTGCGGTCAAGCTCTCGCACCGCTACATCCCGGCGCGCCAGCTGCCGGACAAGTCG
GTCAGCCTGCTCGATACCGCCTGCGCCCGTGTGGCCATCAGCCTGCACGCCGTACCGGCCGAGATCGACG
ACAGCCGCCGGCGCATCGAAGCGCTGGAAACCGAACTGCAGATCATCGCCCGCGAGCACGCCATCGGCAT
CGACGTCAGCCTGCGTCAGGCCAACAGCGAGAGCCTGCTAGCCGCCGAACGCGAGCGCCTGGCCGAGCTG
GAAAGCCGCTGGGCCGAAGAGAAGCAGCTGGTCGATGAACTGCTGGCCACCCGCGCCAGCCTGCGCGAAA
GCGCTGGGGTGGTCGATCAGGACAGCGGCACCGATCACCAGGCCCTGCGCGCGCGGCTGGTCGAATTGCA
GCAGCGCCTGAGCCAGTTGCAGGGCGAAGCCCCGCTGATCCTGCCAACCGTCGATTACCAGGCCGTGGCC
TCGGTGGTGGCGGACTGGACCGGCATCCCGGTCGGACGCATGGCGCGCAACGAGGTCGAGACCGTGCTCA
ACCTCGATAGCCTGCTGGGCAAGCGCATCATCGGCCAGGATCACGCGCTGAAGATGATCGCCAAGCGCAT
CCAGACCTCCCGCGCCGGCCTCGACAACCCCAACAAGCCGATTGGTGTGTTCATGCTCGCCGGCACCTCC
GGCGTCGGTAAGACCGAGACCGCGCTGGCGCTGGCCGAGGCGCTGTATGGCGGTGAGCAGAACCTGATCA
CCATCAACATGAGCGAATTCCAGGAGGCGCACACCGTCTCCACCCTCAAGGGTGCGCCGCCCGGCTATGT
CGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCGGTGCGCCGCCGGCCGTACAGTGTGGTGCTGCTCGAC
GAGGTGGAAAAGGCTCACCCGGACGTGCACGAGATCTTCTTCCAGGTGTTCGACAAGGGCGTGATGGAAG
ACGGCGAAGGGCGTCTGATCGACTTCAAGAACACCCTGATCCTGCTCACCACCAACGCCGGCACCGAACA
GGTGGCGCGCCTGTGCCAGGACGCGGACAACCTGCCCGACCCGGAAAGCATCGCCCGCGACCTGCGTCAG
CCGCTGCTGGAGATCTTCCCGCCGGCGCTGCTCGGCCGTCTGGTGACCATCCCCTATTACCCACTCAGCG
ACACCATGCTCAAGGCCATCACCCGCCTGCAGCTGGGGCGCATCAAGAAGCGCATCGAAAGCACCCACAA
GGTGCCCTTCGACTACGACGAGGCGGTGGTCGACCTGGTGGTTTCGCGCTGCACCGAGAGCGAGAGTGGC
GGCCGGCAGATCGACGCCATTCTCACCAACGGCATGCTGCCGGACATGAGCCGCGAGTTCCTCACCCGCA
TGATGGAAGGCAAGCCGCTGGCCGGTGTGCGCGTCAGTGTGGCCGACAACGACCTGAACTACAGCTTCGC
CGACAACGCCTGA
 Primer design