SecReT6
Protein ID: 330500943
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0029
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]36314..38254 [+]
Productrhs family protein
NoteTssI
UniProt IDF4DV45
KEGG IDpmk:MDS_0029
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-86, Aligned region: 31..327
Phage_base_V [PF04717], Evalue: 2.50E-26, Aligned region: 368..461
Gp5_C [PF06715], Evalue: 1.60E-05, Aligned region: 513..535
Gp5_C [PF06715], Evalue: 1.60E-05, Aligned region: 555..569
Protein Sequence: 646 a.a.     [Download]
>gi|330500943|ref|YP_004377812.1| unnamed protein product [Pseudomonas mendocina NK-01]
MFFAQSSRFARITSPLGPDVLLLRSMHGSDELGRLFEYELQLVSHDANLDLNQLLGKPLTLSVQQHGGGD
RHFHGIVAACGQSVDRGQFAAYRVTLRPWLWLLSRTSDCRIFQHMSVPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEKEGIYYYFRHEADRHVLVLADAYGAHVPAPGYASVPYFPPDGQHRER
DHINDWQLAQHVQPGSMELNDYDFQRPSARIDVRSVMPRPHNAGDYPLYDYPGAYVQSSDGEQYARNRIE
ALQSLHERVELGGSVRGIASGNLFSLTGFGRADQNREYLVVCARYHVLQESLETGSGGGGQFECQLTCTD
AQQTFRPLCGTPKPMVQGPQTAVVVGPAGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQNWAGKN
WGAIQIPRIGQEVIVSFLEGDPDQPIITGRVYNAEQTVPYDLPANATQSGIKSRSSKGGTPANFNEIRME
DKKGAEQLYIHAERNQDIVVEVDETHSVGNNRTKSIGMNETVTIGNNRLRAVKLDDVLLVGSTKTDSISQ
SYLIEVGQNLRLVCGKSILELNASGQINLSGVAINFHASGDAEFNTGGVLNLNIGGGPGATPDGQGDQGS
IDAAVKSLFGQEKGNA
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|330500914|ref|NC_015410.1|:36314-38254 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGTTCTTCGCCCAATCTTCCCGCTTTGCCCGCATCACCAGCCCGCTCGGGCCGGACGTTCTGCTGCTGC
GCTCGATGCACGGCAGCGACGAGCTGGGCCGTCTGTTCGAATACGAGCTGCAACTGGTGTCCCACGATGC
CAACCTCGATCTCAACCAGTTGCTCGGCAAGCCGCTGACGCTCTCAGTGCAGCAGCATGGCGGTGGCGAC
CGGCATTTCCACGGCATCGTCGCCGCCTGCGGGCAGAGCGTCGACCGCGGCCAGTTCGCGGCTTATCGGG
TTACCCTGCGGCCCTGGCTTTGGCTGCTCAGCCGCACCTCCGACTGCCGCATCTTCCAGCACATGAGCGT
GCCGCAGATCATCAAGCAGGTGTTCCGCGACCTGGGGTTCTCCGATTTCGAAGACGCGCTGAGCCGCCCG
TACCGCGAGTGGGAGTACTGCGTGCAGTACCGCGAAACCAGCTTCGACTTCGTCAGCCGGCTGATGGAGA
AGGAGGGCATCTACTACTACTTCCGCCACGAGGCCGATCGCCACGTGCTGGTACTGGCCGATGCCTACGG
CGCGCATGTGCCGGCACCCGGTTACGCCAGCGTGCCCTACTTCCCGCCGGACGGGCAGCACCGCGAGCGT
GACCACATCAACGACTGGCAACTGGCCCAGCACGTGCAGCCGGGCTCGATGGAACTCAACGACTACGACT
TCCAGCGCCCCAGCGCGCGCATCGACGTGCGCTCGGTCATGCCGCGTCCGCACAATGCCGGCGACTATCC
GCTGTACGACTACCCGGGTGCCTACGTGCAGAGCAGCGACGGCGAGCAGTACGCGCGCAATCGCATCGAG
GCGCTGCAGAGTCTGCACGAGCGCGTCGAGCTCGGCGGCAGCGTGCGCGGCATCGCCTCGGGCAACCTGT
TCAGCCTCACCGGCTTCGGTCGCGCCGACCAAAACCGCGAGTACCTGGTGGTCTGCGCGCGCTATCACGT
CCTGCAGGAGTCCCTGGAGACTGGCAGTGGCGGCGGTGGCCAGTTTGAGTGCCAACTCACCTGCACCGAC
GCTCAGCAGACCTTCCGCCCGCTGTGCGGCACGCCCAAGCCGATGGTGCAGGGGCCGCAGACCGCCGTGG
TGGTCGGCCCCGCCGGCGAGGAGATCTGGACCGATCAGTACGGCCGGGTCAAGGTGCACTTCCACTGGGA
TCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATTCGCGTCTCGCAGAACTGGGCCGGCAAGAAC
TGGGGTGCGATCCAGATTCCACGCATCGGCCAGGAGGTCATCGTCAGCTTCCTGGAGGGTGATCCCGACC
AGCCGATCATCACCGGCCGCGTCTACAACGCCGAACAGACCGTGCCCTACGACCTGCCCGCCAACGCCAC
CCAGAGCGGCATCAAGAGCCGCTCCAGCAAGGGCGGCACGCCGGCCAACTTCAACGAAATCCGCATGGAG
GACAAGAAGGGCGCCGAGCAGCTGTACATCCATGCCGAACGCAACCAGGACATCGTCGTCGAGGTGGATG
AAACCCACTCGGTGGGCAACAACCGCACCAAGAGCATCGGCATGAACGAGACGGTGACCATCGGCAACAA
CCGCCTGCGCGCGGTGAAGCTCGATGACGTGCTGCTGGTGGGCTCGACCAAGACCGACAGCATCAGCCAG
AGCTACCTCATCGAGGTCGGCCAGAACCTGCGCCTGGTCTGCGGCAAGAGCATTCTCGAACTCAACGCCA
GCGGTCAGATCAACCTCAGCGGCGTGGCGATCAACTTCCACGCCAGCGGCGACGCGGAATTCAACACAGG
CGGCGTGCTCAACCTGAACATCGGCGGCGGCCCTGGCGCCACCCCCGATGGCCAGGGTGACCAGGGCAGC
ATTGATGCGGCCGTCAAATCCCTGTTCGGGCAAGAGAAAGGAAACGCCTGA
 Primer design