SecReT6
Protein ID: 330500945
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0031
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]38689..43227 [+]
Producthypothetical protein
NotePAAR
UniProt IDF4DV47
KEGG IDpmk:MDS_0031
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 371..387
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 442..463
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 502..539
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 562..589
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 617..651
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 666..693
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 679..715
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 721..757
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 742..778
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 763..799
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 785..820
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 805..838
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 847..879
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 906..941
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 950..984
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1014..1041
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1032..1074
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1088..1120
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1142..1154
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1145..1181
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1166..1194
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1199..1235
RHS_repeat [PF05593], Evalue: 1.70E-68, Aligned region: 1264..1274
DUF4237 [PF14021], Evalue: 1.40E-29, Aligned region: 1417..1512
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 631..643
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 663..689
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 698..715
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 825..836
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 950..962
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 967..978
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 1020..1039
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 1144..1155
RHS [PF03527], Evalue: 8.50E-21, Aligned region: 1253..1291
PAAR_motif [PF05488], Evalue: 2.50E-07, Aligned region: 98..120
PAAR_motif [PF05488], Evalue: 2.50E-07, Aligned region: 97..222
Protein Sequence: 1512 a.a.     [Download]
>gi|330500945|ref|YP_004377814.1| unnamed protein product [Pseudomonas mendocina NK-01]
MSDALWAARLGDDLLHTTLLADIVGGVLEVAAYAAITAVACAAIVAATGLTVLTGGLGGFVLAAVVGIAV
GVGMNKTGWDKGLTTLCEGLGNAISPPNVQAKIVTGANKTKTNGLPSARAAGKLGSAAAPSGTELEQAPP
AEEPEPSFLDMAKSFFSEMWRPTVAQPAPGVIPCPLDAIECKKHPPMPVQLLAEGSIKVSIEGQPAVRSG
DRSTCEATVVESGNISPNVRIGGDAVVVQPIRSGKTPGIGLALAVLMALRGNPRKLCSKLPCLAAGFVGN
MAMGGATAYATNAISNALGSASSGAPNPVHASTGAKVLGEDDDLDFVLPGLMPIEWQRFYSSCDERRDGL
LGAGWSLPFEIAVQVRAHPKGGETLTYIDEQGRPIEIGSLPPGDACYSPGEGLNFRRDESGALLVESVDG
LYRLFEPLPEAPQRLRLSKLGDRNDNRLLLEYDTAGRLRAVRDGHNQLCIELIADARHPQRLGRVERLFA
DERREVLVAYAYDAQGDLSEVRDDKGQLLRRFVYDSGRRLIEHQRPTGLRCFYEWGEFQGADGSEWRVTR
HWTDDGDEYQLHYDLDAGITRVTDGLGRTSERHWNGQYQITRYRDALGQLWLFEWNDERQLLAAVAPDGA
RWQFAYDESGNLCETLDPLGRRDFTQWLGHWSLPEAETDAAGNAWQYRYDKRGNCIAEIDPLGHVTRYRY
DTSGLPVEIIDASGKRKTLRWNALGQLTEQVDCSGYPTRFAYDERGNLVQITDALGEITRYHYDSQGRLL
QTQLADGRGEEFQRDAIGQLSTYLDPAGKPVRYRYDRRGQVRQRIDALGRSVGFEYDAYGRLLALSNEND
ERYRFTWDVLDRLTAQHDLDDSARHYRYDAQGNLIGLAYTPAPHGTGLGSVPETPPAPIIHRFERDAAGR
MIAKHTDDGRTEYAYDPLDRLTGVDFTAADGQMQSLTFAYDALGQLLSEQSAAGALQHAYDELGNLLETQ
LPDQRRIRRLYYGSGHLQLLNLDDQLVSRFERDRLHREVLRTQGQLVTRSQYDRTGRLTARLRRRLEQPV
QLPAEAERRYAYDPSDNLIGRLDRDPASQREQKQQLHYDASGRIIASQDLIRGNLETYSYDAAANLLHPV
GGDAASIGWVRHNKLLTYQDKRYRYDAFGRLVEKRSGRHQVQRLSYDAEHRVREVTNNDGSRVVMHYDPL
GRRIGKSHYDAHGVLLGQTDFTWDGMRLLSETRNGRHSLYLYDEGSYDPLARVDGQGEHARLRYYHTDPN
GLPQQLTEDDGRCIWQARYQVWGNTLAEQQESFFVEEQNLRFQGQYLDRETGLHYNTFRFYDPDIGRFIS
PDPIGLGGGINLYQYAPNPIAWVDPLGLKCSNSWNSFQARSKGVFSSRGQAAKAYSLWKKRDWKTLEAFM
GPGAWPPNRGFVKVKPVVLQPGTKIDRYGGWMDNGKFRDSGTFASPAGASFGSRALPQNTLNKPLNTYEV
VKPVKADAGPAIPWFGQPGKGTQYELSKSIDELLKQGAIKKI
 
Nucleotide Sequence: 4539 bp     [Download]
>gi|330500914|ref|NC_015410.1|:38689-43227 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGTCTGATGCGCTCTGGGCCGCCCGGCTCGGCGACGATCTGCTGCACACCACATTGCTCGCCGACATCG
TCGGCGGCGTGCTGGAAGTGGCCGCCTATGCCGCCATCACCGCCGTGGCCTGTGCCGCGATAGTCGCCGC
CACCGGCCTGACCGTCCTTACCGGCGGTCTCGGTGGCTTTGTTCTCGCTGCAGTAGTAGGTATCGCCGTG
GGGGTCGGCATGAACAAAACCGGCTGGGACAAGGGTCTCACGACCCTCTGCGAAGGCCTGGGCAACGCCA
TCTCCCCGCCCAATGTTCAGGCCAAGATCGTTACCGGCGCCAACAAGACCAAAACCAACGGCCTGCCTTC
CGCGCGCGCCGCTGGCAAGCTGGGTAGCGCTGCTGCGCCGTCCGGCACCGAGCTGGAGCAGGCGCCGCCC
GCCGAGGAGCCGGAGCCGAGCTTCCTGGACATGGCCAAGAGCTTCTTCAGTGAGATGTGGCGCCCCACCG
TTGCCCAGCCGGCACCCGGCGTCATCCCCTGCCCGCTGGATGCCATCGAGTGCAAGAAGCATCCGCCGAT
GCCGGTGCAGCTGCTGGCCGAAGGCTCGATCAAGGTCAGCATCGAAGGCCAGCCGGCAGTGCGCAGCGGT
GATCGCAGCACCTGCGAGGCCACGGTGGTGGAAAGCGGCAACATTTCGCCGAACGTGCGCATCGGTGGCG
ACGCCGTGGTGGTGCAGCCGATTCGCAGCGGCAAGACGCCCGGCATCGGCCTTGCCCTGGCCGTGCTCAT
GGCGTTGCGCGGTAACCCGCGCAAGCTGTGCAGCAAGCTGCCCTGCCTGGCCGCTGGTTTCGTCGGCAAC
ATGGCCATGGGTGGCGCGACCGCCTATGCCACCAACGCCATCTCCAACGCCCTCGGCTCGGCCAGCAGCG
GTGCACCCAACCCGGTGCACGCCAGCACCGGGGCCAAGGTGCTCGGTGAAGACGACGACCTCGACTTCGT
CCTGCCGGGGCTGATGCCCATCGAGTGGCAGCGTTTCTACAGCAGCTGCGACGAGCGTCGTGACGGCCTA
CTGGGTGCCGGCTGGAGCCTGCCGTTCGAGATCGCCGTGCAGGTACGCGCCCACCCGAAGGGCGGCGAAA
CGCTGACCTATATCGACGAGCAGGGCCGCCCCATCGAGATTGGCAGCCTGCCACCGGGCGATGCCTGCTA
CAGCCCGGGCGAAGGTTTGAACTTCCGCCGCGATGAAAGCGGTGCACTGCTGGTGGAAAGCGTCGATGGT
CTCTACCGCCTGTTCGAGCCTCTGCCCGAAGCGCCGCAGCGGCTGCGCCTGAGCAAGCTGGGTGATCGCA
ACGACAACCGCCTGCTGCTCGAATACGACACCGCTGGCCGGCTACGCGCTGTGCGCGATGGCCATAACCA
GCTGTGCATTGAACTGATTGCCGACGCCCGCCACCCGCAGCGCCTGGGCCGGGTCGAGCGCCTGTTCGCC
GATGAGCGGCGCGAGGTGCTGGTCGCTTATGCCTATGACGCACAGGGCGATCTCAGTGAAGTCCGCGACG
ACAAGGGCCAACTGCTGCGTCGCTTCGTCTACGACAGCGGCCGCCGCCTGATCGAACACCAGCGCCCCAC
TGGCCTGCGCTGCTTCTACGAATGGGGCGAGTTTCAGGGTGCCGATGGTAGCGAATGGCGGGTGACACGG
CACTGGACCGACGACGGCGACGAATACCAGCTGCATTACGATCTGGATGCGGGCATCACCCGGGTCACCG
ATGGCCTTGGCCGCACCAGCGAACGCCACTGGAACGGTCAGTACCAGATCACCCGCTATCGCGACGCCCT
CGGCCAGCTCTGGCTGTTCGAATGGAACGACGAACGCCAACTGCTGGCCGCCGTCGCACCCGACGGCGCG
CGTTGGCAATTCGCCTATGACGAGTCCGGCAACCTCTGCGAAACCCTCGACCCGTTGGGGCGTCGAGACT
TCACCCAGTGGCTTGGCCACTGGTCGCTGCCGGAAGCCGAGACCGACGCCGCCGGCAATGCCTGGCAGTA
CCGTTACGATAAGCGCGGCAACTGCATCGCCGAGATCGACCCGCTTGGCCATGTCACCCGCTATCGCTAT
GACACCAGCGGTCTGCCGGTAGAGATCATCGACGCCAGCGGCAAGCGCAAGACCCTGCGCTGGAACGCCC
TCGGCCAGCTCACCGAGCAGGTCGACTGTTCCGGCTACCCCACGCGCTTCGCCTACGACGAGCGCGGCAA
CCTGGTGCAGATCACCGATGCCCTCGGCGAGATCACCCGCTACCACTACGACAGCCAGGGACGCCTGCTG
CAGACGCAACTCGCCGACGGCCGTGGCGAGGAGTTTCAACGCGACGCCATCGGCCAGCTCAGCACCTACC
TCGATCCTGCCGGCAAGCCCGTGCGCTATCGCTATGACCGCCGTGGTCAGGTTCGCCAGCGCATCGATGC
CCTGGGCCGCAGCGTCGGCTTCGAATACGACGCCTATGGCCGCCTGCTCGCCCTGAGCAACGAGAACGAC
GAACGCTACCGGTTCACCTGGGACGTGCTCGACCGCCTCACTGCCCAGCACGACCTCGACGACAGCGCCC
GCCATTACCGCTACGACGCACAAGGCAACCTGATCGGCCTGGCCTATACCCCGGCTCCACATGGCACGGG
CCTGGGCAGTGTCCCGGAGACGCCGCCGGCTCCGATCATCCACCGCTTCGAGCGGGATGCCGCTGGCCGG
ATGATCGCCAAGCACACCGATGACGGTCGCACCGAATACGCCTACGACCCGCTTGATCGCCTGACGGGGG
TCGACTTCACCGCGGCTGACGGCCAGATGCAGTCGCTGACCTTCGCCTACGACGCCCTTGGCCAACTACT
CAGCGAACAGAGCGCCGCCGGTGCCCTGCAGCATGCCTACGACGAACTCGGCAACCTGCTGGAAACGCAA
CTACCTGACCAGCGCCGTATCCGCCGCCTGTACTACGGCAGCGGCCACCTGCAACTGCTTAACCTGGATG
ATCAACTGGTCAGCCGCTTCGAGCGCGACCGCCTGCATCGCGAGGTGCTACGCACCCAGGGGCAGCTCGT
AACCCGTAGCCAGTACGACCGAACCGGACGCCTTACCGCACGCCTGCGCCGACGCCTGGAGCAACCGGTG
CAGCTGCCGGCCGAAGCCGAACGGCGCTATGCCTACGACCCCAGCGACAATTTGATCGGCCGCCTCGACC
GTGATCCGGCCAGCCAGCGCGAACAGAAGCAGCAGCTGCACTACGATGCTAGCGGGCGCATCATCGCCAG
CCAGGACCTGATTCGCGGCAATCTGGAAACCTACAGCTACGACGCTGCCGCCAACCTGCTGCACCCGGTC
GGCGGCGACGCCGCCAGCATCGGTTGGGTGCGTCACAACAAACTGCTCACCTATCAGGACAAGCGCTACC
GCTACGACGCCTTCGGCCGGTTAGTGGAAAAACGCAGCGGCCGTCACCAAGTGCAGCGCCTGAGCTACGA
CGCCGAACACCGCGTGCGGGAAGTCACCAACAACGACGGCAGCCGCGTGGTCATGCACTACGATCCGCTC
GGCCGGCGTATCGGCAAAAGCCACTACGATGCCCACGGCGTGTTGCTCGGCCAGACCGACTTCACCTGGG
ACGGCATGCGCCTGCTCAGCGAGACCCGCAATGGCCGGCACAGCCTCTACCTCTACGACGAAGGCAGCTA
CGATCCGCTGGCGCGCGTCGACGGCCAGGGTGAACACGCGCGCCTGCGCTATTACCACACCGATCCGAAC
GGGCTACCGCAGCAACTCACCGAAGACGACGGCCGCTGCATCTGGCAGGCCCGCTACCAGGTCTGGGGCA
ACACCCTGGCCGAACAGCAGGAAAGCTTCTTTGTCGAAGAGCAGAACCTGCGCTTCCAAGGCCAGTACCT
GGACCGCGAAACCGGACTGCACTACAACACCTTCAGATTCTACGATCCGGATATTGGACGGTTTATCAGC
CCGGATCCGATTGGGTTGGGGGGCGGCATAAACCTCTACCAATACGCTCCCAACCCTATTGCCTGGGTCG
ACCCTTTAGGCCTCAAATGCAGCAACTCTTGGAATAGCTTCCAAGCGCGCTCCAAGGGAGTATTTTCTTC
GAGGGGGCAGGCAGCCAAGGCTTATTCGCTTTGGAAGAAGAGAGATTGGAAAACTCTTGAGGCATTCATG
GGGCCTGGTGCCTGGCCACCAAATCGGGGCTTCGTTAAAGTCAAACCAGTAGTCCTTCAACCCGGTACTA
AGATTGACCGTTATGGCGGCTGGATGGATAACGGAAAGTTTAGGGATTCAGGTACTTTCGCATCTCCCGC
TGGGGCTTCTTTTGGCAGCCGGGCACTGCCTCAGAACACCCTGAATAAACCGCTGAATACTTATGAGGTG
GTTAAGCCGGTCAAAGCCGACGCTGGCCCAGCTATACCCTGGTTCGGGCAGCCTGGTAAAGGCACCCAAT
ATGAGTTATCAAAATCTATCGACGAGCTGCTGAAACAAGGTGCGATAAAAAAAATTTAG
 Primer design