SecReT6
Protein ID: 330810170
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3312
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4093970..4097794 [-]
Producthypothetical protein
NoteTssM
UniProt IDF2K7N7
KEGG IDpba:PSEBR_a3312
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.00E-32, Aligned region: 114..354
DUF1215 [PF06744], Evalue: 0.0023, Aligned region: 998..1044
Protein Sequence: 1274 a.a.     [Download]
>gi|330810170|ref|YP_004354632.1| hypothetical protein PSEBR_a3312 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSTLSIVALVVLAIVVVLLIAALIWWLRTQGGAAIRSFYGAVRRMEQEQGTRDRYQMPWLMMLGNESDGA
QLCAQWRLQPTDKAAWFGRWFSDAEGSVLVVPQALFLPDEGMNRQRGNWWRLLGLMLRLRSKRPLDAVIW
TVPFSTLDDIEHTTELSLKVRRCFIDLLQRFGLSLPVYVVITGMEELPGVQELVSALPAEARESMLGWSS
PYLPDAAWQSQWSDQALDQVNAALSQSIIEIGALSGQLGSDLYGLPERFEGLRRALQILLEPVFQGNAQG
EAPRCRGVYFTASQAPAVSGDGLTAADSAQRQTVFARQLWSRRLVAERGLAQPVPRLLRLRQRGHRLVGA
VALVVGLVWLGGMVWVWHDSVEEAEGLSRLILSTHKNHLVVDPDEPQLEPTRHNVQNYWNMLEKAPRWRF
VSVVFPTSWFSSVDTQLENGLRLTARHHWILPLRDLLNSDLEQLKSIRNTERRGNVENEDPAQWQSYVKA
KALVDLAVRLEQHNQMFSQVVNDPKAPLDELVQLSNTALSLGLNTGTLSRPRFYNRVLFDAQNSDLKGLD
LNAARPVISDNFTGLMQRWLDHYFLADNFVRQAGYLKLHLQRLEAGGGNSLSELEDLMALIDDLQTLVSL
TNSAWGRGKGQDLVPGYSQMLDKVSHSTLLGPDIEQDLESQAAKLQQSFRDQWIVQTGSRDNLLVQQGSG
LLVLQDHVTALDGAVQALFKRDFVALAMQKDPSGNNPDSMGQGDGSDDFSVALNYFASYKSYANEEMPRI
PPDYRDALMQAAEGAAARAMWLSLDESDEALPGMGFNVQTTQAVALQKAFMDVHRGDLAIRFQRLLNRRA
LAQLKSGLDEIDAQPLFSQRADVQRWDGSKNFGLQLYGASDPQDLKLNLAQQFGAMLQIAEQRMPALEWL
IVQQDNLSALEHDQVARFMALNDELLKYKNQNPASSAAQLEQLVSRDFIAMDTTSCAQILQTSSLPGGRG
DLALRTVALQQGALQRCLYLQQSQAATAWNDVANYFNQYLAGRFPFSQDVRASDADPARVQRLLELIDTR
LPLAQAGLTLSQTPERLAAEDFLNRLKQAGTWLGPLFVRDKSGILGVEMDVRWRTDRDEERGADQVIAWS
LDAGNQQISYPGGGQQNLRWMVGQPVRLTLRWARNGYQRPANDPLQPNLVVRDLEAGWEYQGPWSLLRLM
RSLVSVQRQPNVDYTDFPLALQLPVTAQTQASTAQQTLMFMRLSLMSQGSKLPLSIPPLPTRAPRSPFMA
TASSPAIATREEGL
 
Nucleotide Sequence: 3825 bp     [Download]
>ref|NC_015379.1|:c4097794-4093970 hypothetical protein PSEBR_a3312 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGCACCCTGAGTATCGTTGCCCTGGTGGTGCTCGCCATCGTCGTGGTGCTGTTGATCGCGGCCCTGA
TCTGGTGGCTGCGGACCCAAGGCGGAGCGGCGATCCGCAGTTTCTATGGGGCGGTGCGCCGCATGGAACA
GGAGCAGGGCACCCGGGACCGCTATCAGATGCCTTGGCTGATGATGCTCGGTAACGAAAGCGACGGCGCC
CAACTGTGCGCCCAGTGGCGCTTGCAACCGACCGACAAGGCCGCCTGGTTCGGGCGCTGGTTTTCCGATG
CCGAGGGCTCGGTGCTGGTGGTGCCCCAGGCGTTGTTCCTGCCCGATGAAGGCATGAACCGGCAACGGGG
TAATTGGTGGCGCCTGTTGGGGCTGATGTTGCGCTTGCGCAGCAAGCGACCATTGGATGCGGTGATCTGG
ACGGTGCCGTTCAGCACCCTCGATGACATCGAACACACCACCGAACTGAGCCTCAAGGTCCGGCGGTGCT
TTATCGACCTGTTGCAACGGTTCGGCCTCAGCCTGCCGGTGTACGTGGTGATCACCGGGATGGAAGAGCT
GCCCGGGGTCCAGGAACTGGTCAGCGCGCTGCCCGCCGAGGCGCGTGAATCGATGCTGGGCTGGTCCTCG
CCCTATTTGCCGGATGCGGCCTGGCAGTCGCAGTGGAGTGACCAGGCCCTGGACCAGGTCAACGCGGCGC
TGTCGCAATCGATCATCGAGATCGGTGCGCTGTCGGGGCAATTGGGCAGCGATCTGTATGGGTTGCCGGA
GCGCTTCGAAGGCTTGCGACGGGCCTTGCAGATCCTGTTGGAGCCGGTGTTCCAGGGCAATGCCCAAGGC
GAAGCGCCGCGTTGTCGCGGGGTGTATTTCACTGCCAGCCAGGCGCCGGCTGTCAGCGGTGATGGTTTGA
CCGCCGCCGACAGTGCCCAGCGGCAAACCGTGTTCGCCCGTCAATTGTGGTCACGACGGCTGGTGGCCGA
GCGTGGCCTGGCCCAGCCCGTGCCGCGGCTGTTGCGCCTGCGCCAGCGCGGGCATCGGCTGGTCGGAGCG
GTGGCGTTGGTGGTGGGCCTGGTCTGGTTGGGTGGCATGGTCTGGGTCTGGCACGATTCGGTGGAAGAAG
CCGAAGGGCTGTCGCGGTTGATCCTCAGCACCCATAAGAATCACCTCGTGGTCGATCCTGACGAACCGCA
GCTGGAACCGACCCGGCACAACGTGCAGAACTATTGGAACATGTTGGAAAAGGCCCCGCGCTGGCGCTTT
GTCTCGGTGGTCTTTCCCACTTCGTGGTTCTCTTCCGTGGACACGCAGCTGGAGAATGGGTTGCGCCTGA
CTGCTCGGCACCATTGGATATTGCCTCTGCGGGACCTGCTCAATTCAGACCTGGAACAGCTCAAATCCAT
CCGCAACACCGAGCGGCGGGGCAATGTGGAAAACGAAGATCCGGCGCAATGGCAGAGCTACGTGAAGGCC
AAGGCGCTGGTGGACCTGGCGGTACGCCTTGAACAGCACAACCAGATGTTCAGCCAGGTGGTGAACGATC
CCAAGGCACCGCTGGACGAACTGGTGCAACTGAGCAACACCGCCTTGTCCCTGGGGCTCAACACCGGCAC
CTTGAGCCGGCCCCGGTTCTATAACCGGGTGCTGTTCGATGCCCAGAACAGCGATTTGAAAGGGCTGGAC
CTGAACGCCGCGCGCCCGGTGATCTCCGATAACTTCACCGGCCTGATGCAGCGCTGGTTGGACCATTACT
TCCTGGCGGACAACTTCGTGCGCCAGGCCGGCTACCTCAAACTGCACCTGCAACGGCTGGAGGCCGGCGG
CGGCAACTCCTTGAGCGAACTCGAAGACCTGATGGCGCTGATCGACGATTTGCAGACCCTGGTCAGCCTG
ACCAACTCGGCCTGGGGGCGGGGCAAGGGCCAGGACCTGGTCCCCGGCTACAGCCAGATGCTGGACAAGG
TCAGCCACAGTACTTTGCTGGGGCCGGATATCGAGCAGGACCTGGAGAGCCAGGCGGCGAAGTTGCAGCA
GAGCTTTCGTGACCAGTGGATCGTCCAGACCGGCTCCCGGGACAATCTGCTGGTGCAACAGGGCAGTGGC
CTTCTGGTCTTGCAAGACCATGTCACGGCGCTGGACGGTGCAGTGCAGGCTTTGTTCAAGCGTGATTTCG
TGGCGCTGGCCATGCAGAAGGATCCGTCGGGCAACAACCCCGATTCGATGGGCCAGGGCGATGGCAGCGA
TGATTTCAGCGTCGCGCTGAACTACTTCGCCAGCTACAAGAGCTATGCCAATGAAGAAATGCCGCGCATT
CCGCCGGATTACCGTGACGCGCTGATGCAGGCCGCTGAAGGTGCCGCGGCCCGGGCCATGTGGTTGAGCC
TGGATGAAAGCGACGAGGCGTTGCCCGGCATGGGCTTCAATGTGCAAACGACCCAGGCCGTTGCGCTGCA
AAAGGCCTTTATGGACGTGCACCGTGGCGACCTGGCGATCCGTTTCCAACGTCTGCTCAATCGCCGGGCA
TTGGCGCAGCTCAAGAGTGGCCTGGACGAAATCGATGCCCAGCCGCTGTTCAGCCAGCGGGCCGATGTCC
AGCGTTGGGATGGCTCGAAAAACTTCGGCTTGCAACTCTACGGTGCCAGCGATCCACAAGACCTGAAGCT
GAACCTGGCCCAGCAATTCGGCGCGATGCTGCAGATCGCCGAGCAGCGAATGCCCGCGCTGGAATGGTTG
ATTGTCCAGCAGGACAACCTGTCGGCCCTGGAGCACGACCAGGTGGCACGCTTCATGGCCCTCAACGATG
AATTGCTCAAGTACAAGAACCAGAACCCGGCCAGCTCGGCGGCTCAGCTGGAACAATTGGTGAGTCGGGA
CTTTATCGCCATGGACACCACCTCCTGCGCGCAGATCTTGCAGACCTCCAGCCTGCCCGGTGGTCGCGGT
GACCTGGCCCTGCGCACGGTCGCGTTGCAGCAGGGCGCCCTGCAACGGTGCCTGTACCTGCAACAGAGCC
AGGCGGCGACGGCCTGGAATGACGTGGCCAACTATTTCAATCAATACCTGGCCGGGCGCTTTCCGTTTTC
TCAGGATGTGCGGGCCAGCGATGCCGACCCGGCGCGGGTCCAGCGTTTGCTGGAACTGATTGACACACGC
CTGCCCCTGGCCCAGGCCGGACTGACGCTGAGCCAGACGCCGGAGCGGCTGGCGGCCGAGGATTTCCTCA
ACCGTTTGAAACAGGCCGGTACTTGGCTCGGGCCGCTGTTCGTGCGGGACAAGAGTGGCATTCTTGGGGT
GGAAATGGACGTGCGCTGGCGTACCGATCGCGATGAGGAGCGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGGACGCCGGCAACCAACAGATCAGCTACCCCGGCGGCGGCCAGCAGAACCTGCGCTGGATGGTCGGCC
AGCCCGTACGCCTGACCTTGCGCTGGGCCCGTAACGGTTATCAGCGTCCGGCCAACGACCCGCTGCAACC
GAACCTGGTGGTGCGCGACCTGGAGGCCGGTTGGGAGTACCAGGGGCCCTGGTCGTTGCTGCGCCTGATG
CGCTCGCTGGTGTCGGTCCAGCGCCAGCCAAATGTCGACTACACCGATTTTCCCCTGGCCCTGCAACTGC
CGGTGACCGCCCAGACCCAGGCCAGCACGGCGCAGCAAACGTTGATGTTCATGCGCCTGTCGTTGATGAG
CCAGGGCTCCAAGCTGCCTTTGTCGATCCCACCGCTGCCGACGCGGGCGCCCCGTTCACCTTTCATGGCG
ACCGCATCGAGCCCCGCCATCGCCACCCGTGAGGAGGGCCTGTGA
 Primer design