SecReT6
Protein ID: 330812624
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5552
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6692399..6695899 [-]
Producthypothetical protein
NoteTssM
UniProt IDF2K705
KEGG IDpba:PSEBR_a5552
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.90E-96, Aligned region: 76..122
ImcF-related_N [PF14331], Evalue: 3.90E-96, Aligned region: 187..449
ImcF-related_N [PF14331], Evalue: 3.90E-96, Aligned region: 700..744
IcmF-related [PF06761], Evalue: 1.50E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 1.30E-39, Aligned region: 691..724
DUF1215 [PF06744], Evalue: 1.30E-39, Aligned region: 904..1025
AAA_16 [PF13191], Evalue: 0.0043, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0043, Aligned region: 608..629
AAA_16 [PF13191], Evalue: 0.0043, Aligned region: 777..777
Protein Sequence: 1166 a.a.     [Download]
>gi|330812624|ref|YP_004357086.1| hypothetical protein PSEBR_a5552 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MKAFFSFMTRWVIPLLGLIALSLIIWFVGPLLDWLVPEGRRWALIILVFAVWIAYRVLRIIQARRQAAEV
MRSLAAQTPPDPTSIATAEELETLRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSDATIDKAAWLGFLGLLKKQRARR
PIDGAFIAISLSDLLLGSDAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEYFDTLSKEE
RAQVWGMTFALDDGKSSDSPLAHLQSEFTGLEQRLNDRLVERLQQERDPARRDLIYGFPQQFGALKDCLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIEKLFTAV
AFAERGLVGVDPKVERRRKWIARGVLASTVVLVLVVSTLWWVSYRANQAYIAQVDQKVAPLGQTVQNLSP
AQRDVLAVLPLLNAVKHLADDAPSWAEGLGLYQGDMLEAESGSVYRKLLIAVFAPRLLTRIEEQLHSGGN
SDFLYEGLKAYLMLADTEHYDADFIKAWIALDWDRSLPRDLPAEQRQALTAHLQALFERRPPLARLDPRL
VEDLRRQLQQLPVAQRVYDRIKRQKLPEGIPDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTVKGYRQ
GFLLTSLSQTGTLAEEQWVLGHEEADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVAKETDLQQDERLLAAQGAPVEGGVDKLKERLGSLLGQEQATQNAPAQSDDPI
TAHFAELNSIVSKSEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQATAAATRVSLNAERQPP
LVQGLVKSVVNSTTNSMMGGVRNQLNAAWTSEVVNIYRQSLAGRYPMSPGSARDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSTPTWRWQPGAAQKLGIAPGVLQTFQRAATIRDAFFRSGGTQPMVRFELKPVAMDS
TITQFLLDLDGQQLSYDHGPSRPTAMQWPNPGSIGVVRISIMPPSSSGRSGITLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASASYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>ref|NC_015379.1|:c6695899-6692399 hypothetical protein PSEBR_a5552 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
GTGAAGGCGTTTTTCAGTTTTATGACCCGCTGGGTCATCCCATTGCTGGGGCTGATCGCCCTGAGCCTGA
TCATCTGGTTCGTTGGCCCGCTGCTCGATTGGCTGGTGCCCGAAGGCCGCCGCTGGGCCTTGATCATCCT
GGTGTTCGCGGTATGGATCGCCTACCGGGTGCTGCGCATCATCCAGGCGCGCCGTCAGGCCGCCGAAGTG
ATGCGCAGCCTGGCCGCGCAAACCCCACCGGACCCGACCAGCATCGCCACCGCCGAAGAGCTCGAAACCC
TGCGCCAGCGCATGGACGAAGCCTTGGCCCTGCTCAAGAAAGCCAAGCTGGGCGGTGACGAGCGCCGCAA
CCTCTACGAGCTGCCGTGGTACGTGATCATCGGCCCGCCGGGTTCGGGCAAGACCACCGCGCTGGTCAAC
TCCGGGCTGCATTTCCCACTGGCCGCGCAACTGGGCGCCGGCGCGGTACGCGGTGTCGGCGGCACGCGCA
ATTGCGATTGGTGGTTCACCGACCAGGCGGTCCTGCTCGACACCGCCGGCCGCTACACCACCCAGGACAG
CGACGCGACCATCGACAAGGCCGCCTGGCTGGGCTTCCTGGGTCTGTTGAAAAAACAACGGGCCCGGCGC
CCGATTGATGGCGCGTTCATCGCCATCAGCCTGTCCGACCTGCTGCTGGGCAGCGACGCCGAGCGCGCCG
CCCATGCCGCCGCAATCCGGCTGCGGATCCAGGAGCTGTACACCCAACTGGGTGTGCGCTTCCCGATCTA
CCTGATGCTGACCAAGCTCGACCTCGTGCCGGGGTTCATGGAGTATTTCGATACCCTGAGCAAGGAAGAG
CGCGCCCAGGTCTGGGGCATGACCTTCGCCCTGGACGATGGCAAGAGCAGCGATAGCCCGCTGGCGCACC
TGCAAAGCGAATTCACCGGCCTTGAGCAGCGGCTCAACGACCGCTTGGTGGAACGCCTGCAACAAGAGCG
CGACCCGGCGCGGCGCGATCTGATCTACGGTTTCCCGCAGCAGTTCGGCGCCTTGAAAGATTGCCTGCAA
AGCTTCCTCGAAGGCGTGTTCAAACCCAACGCCTTCGAAGAGCGCGTGTTGCTGCGTGGCGTGTATTTCA
CCAGTGGCACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCTCCATGGCCCAGAGCATGAACCTGGA
TCGTCAGCACCTGGCGCGCCAGACCGGCACCGGGCGCAGTTATTTCATCGAAAAACTCTTCACCGCCGTG
GCCTTCGCCGAGCGCGGGCTGGTGGGCGTCGATCCGAAAGTCGAGCGGCGGCGCAAGTGGATCGCCCGCG
GCGTATTGGCCTCCACCGTGGTGCTGGTGTTGGTGGTCAGCACGTTGTGGTGGGTCAGCTATCGCGCCAA
CCAGGCCTACATTGCCCAGGTCGACCAGAAGGTCGCGCCGTTGGGGCAAACCGTGCAGAACCTCAGCCCG
GCGCAACGCGACGTCCTCGCCGTGTTGCCGTTGCTCAACGCCGTGAAACACCTGGCTGACGACGCACCGA
GCTGGGCCGAAGGCCTGGGCTTGTACCAGGGCGACATGCTCGAAGCCGAGTCCGGCAGCGTCTACCGCAA
GCTGCTGATCGCGGTGTTCGCGCCACGTCTGCTGACGCGGATCGAAGAGCAGCTGCACAGCGGCGGCAAT
TCGGATTTCCTCTACGAAGGCTTGAAGGCCTACCTGATGCTCGCCGACACCGAGCATTACGATGCCGACT
TCATCAAGGCCTGGATCGCCCTGGATTGGGACCGCAGCCTGCCGCGGGATTTGCCGGCCGAGCAGCGCCA
GGCCCTGACCGCGCATTTGCAGGCGCTGTTCGAGCGGCGTCCGCCCCTCGCGCGCCTCGATCCTCGCCTG
GTCGAAGACCTGCGCCGCCAGTTGCAGCAATTGCCGGTGGCCCAGCGGGTCTATGACCGGATCAAGCGCC
AGAAGCTGCCCGAAGGCATCCCGGACTTCCGTATCAACGAAGCCGCCGGGCGTGACGCGGCGCTGGTGTT
CAGCCGCAAGAGCGGCAAGCCATTGGGCGAGCCGCTGAGCGGGTTCTTCACCGTCAAGGGTTACCGCCAG
GGCTTCTTGCTCACCAGCCTGAGCCAGACCGGCACCCTGGCCGAAGAGCAATGGGTGCTTGGCCACGAAG
AGGCCGATCAGCAGAACGTCGCCAGCCTGGCTGCCGATGTGCGTCGCCTGTACTTCCAGGACTACCTGCG
CCAATGGGACGCCTTGCTGGCCGACATCGACTTTGTGCCGATCACCAGCGTGGCCCAGGCCGCCGATGTG
CTGCGGGTGATTTCCGGCCCGACCTCACCGTTGAAAAAACTGCTGGTGGCGGTGGCGAAGGAAACCGACC
TGCAACAGGATGAACGCCTGCTGGCTGCCCAAGGTGCGCCGGTAGAAGGCGGTGTGGACAAGCTCAAGGA
ACGCCTGGGCAGCTTGCTCGGCCAGGAGCAGGCGACGCAAAACGCACCGGCGCAAAGCGATGATCCGATC
ACCGCGCACTTCGCCGAGCTCAACAGCATCGTCAGCAAAAGCGAAGGCGAGCCGGCGGCCATCGACGGTT
TGCTGGCCGACATGAACGCTTTGTACGTGCAGGTCAGCGCCATGGTCGGTGCCAGCGGCGACGCCTTGCT
CGGCGAAGCCAAGAACCAGGCCACGGCCGCCGCTACACGCGTCAGCCTTAATGCCGAACGCCAGCCGCCG
CTGGTGCAGGGCCTGGTCAAGTCGGTGGTCAACTCCACCACCAACAGCATGATGGGCGGGGTGCGCAACC
AACTGAACGCCGCTTGGACCAGCGAAGTGGTGAACATCTATCGCCAGTCCCTGGCCGGGCGCTATCCGAT
GTCGCCAGGCAGTGCGCGGGACGCGACCCTGGATGACTTCGGCCAGTTCTTCGGCGTCGGCGGGGTGATG
GACAACTACTTCCGCAAGTACCTGCAACCCTACGTCGACACCTCGACCCCGACCTGGCGCTGGCAGCCGG
GCGCGGCGCAGAAGCTCGGCATCGCCCCTGGCGTGCTGCAGACCTTCCAGCGCGCGGCGACCATCCGCGA
TGCGTTCTTCCGTTCCGGTGGCACGCAGCCGATGGTGCGTTTCGAACTCAAGCCGGTGGCGATGGACTCG
ACCATCACCCAGTTCCTGCTCGACCTCGACGGCCAGCAACTGAGCTACGACCACGGCCCAAGCCGGCCGA
CCGCCATGCAGTGGCCGAACCCGGGCAGCATCGGCGTGGTGCGGATCTCGATCATGCCGCCGTCGTCCAG
CGGTCGCTCCGGCATCACCCTGGATGGGCCGTGGGCCTGGTTCCGGCTGCTGGAACAATCGGATCTGACC
GCCGGCAACTCGCCGGATCGCTTCAACCTGCGGCTGCGGGTCGATGGTGCCAGCGCCTCTTATGAGCTGC
GGGCCAACAGCGCCTTCAACCCATTCAAGAGCCGGGTGCTCAGCGGCTTCAGCCTGCCGGAGCGGCTATG
A
 Primer design