SecReT6
Protein ID: 330814654
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2350
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]248838..252908 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDF2LSX7
KEGG IDbgd:bgla_4p2350
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-98, Aligned region: 632..952
ImcF-related_N [PF14331], Evalue: 7.60E-92, Aligned region: 317..585
DUF1215 [PF06744], Evalue: 2.20E-35, Aligned region: 949..978
DUF1215 [PF06744], Evalue: 2.20E-35, Aligned region: 1061..1185
Protein Sequence: 1356 a.a.     [Download]
>gi|330814654|ref|YP_004362829.1| ImcF domain-containing protein [Burkholderia gladioli BSR3]
MKKFLSFLASRQFLAFLALIVVALVIWLVGPFFAFGGLKPLAGAGMRVLLIALVLVGVLLWLGGWSTSIV
FVALLCLLIWYAAPLLSFGHTSPFEPISARIGAIALVVVVFALFWMFRLWQKMREDEAFLKKVLRFGGKT
EESPAAPRLKKVEAIVTSALARLKSMRTGARGPGKLFQGKRYLYELPWYITLGSRGAGKTSALLNGGLAF
PIAEQMQRAAGKSASDAASVDWWLTNDAVLIDTAGYYTRHGTSTVKEGEGLAPSSDRPATAASSEDKAGK
DGEEKKGDASGDTRAATLAKSSANIVPIRADSPEQREALDRAEWLGFLGMLRRHRPRAPINGALLAVDLD
SLVGADEQKRLAEASALRARLGELRGELGIRFPVYVLVTKMDRLTGFAEYFSGLTAESRAQAWGFTLPYG
KETVAKEGLRARCRDELMQMAGRLSGMIHTRLQDEDETHKRRQLAALPEEFSALVGPLVDLIDRVFLDSR
YDDTQLHSTLRGVYFTSAQQDGHSVIAERDTVVQRLASKQGQAGAAGGHEGNRSYFLHDVLTRVVFPEAH
LVSPNLRWEYRYRLLRLIGHALALLLFVWLALGLRVSFGNNSDYLDVIGRKVQALAARVTQLYKEPNPEA
VPDTLTEARYLPTFPNLDLSDPGSTWRYGLYTPPDIVTESGHTYDALEDNLLVPQIVRRMESVMSGAIAN
KDPKAAYDALRVYLMLYDKAKFNAGDVKIWVLDDWAKNDSAAVFGGRASMIDHVQQLFSGDRVVKSPLIR
NDALIQQARAFLDGSNATDRLYQRAKAAMLKESPDEFTLLRAVGPQAGTVFTRASGQPLSRGVPGLFTFD
GYRNLFDKRLPEFVQIARDDDAWVMGRSYLGEAQKKTAEIVSTVTGADDALTDAVRRQYLLEYAQQWDAF
LNDIRTVSGTSLAFNLQVLRSFAAPDSPLGRLARAAVRETTLTAPVTASDGSFLQKAADQLNQKADKALG
IRASERVERELVDSHFAALREVVTGNADSQVGAQAAAAQAGKTGLDGVTNLLNDYYTALTVSDNALSNNS
MPPASDTAAKLKMTANTMPAPFRAVLLQLAADGSHEVNQGIGQLLSRQMQAVVGDTCRLAIEGNYPFSPD
SKRDVSIDDFTRVFAQGGVIDDFFGKTLAPFVDTSAKPWRYKTLAGATEPVQGPDLEPFEHAKAIRDVFF
NDPGHKQLTWKADIRIPELDPTITSLSLDIDGQTSLYQHGPVAPFAVTWPGPRGGVHTEITANPRIRPDT
STIAADGPWALMRLLQKGQVVETATPGRTRVAFDFDGRKAVLDVASTGSVANPLTSDVLKTFRCPSSMPV
FNLSDSGPPPGLPRGTTPASPANVTQ
 
Nucleotide Sequence: 4071 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c252908-248838 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGAAGAAGTTTTTGTCATTTCTCGCTTCGCGCCAGTTTCTCGCGTTCCTCGCGCTGATCGTCGTTGCGC
TGGTGATCTGGTTGGTCGGACCGTTCTTCGCGTTCGGCGGCCTCAAGCCGCTGGCGGGCGCCGGCATGCG
GGTGCTGCTGATTGCGCTGGTGCTTGTGGGCGTGTTGCTCTGGCTCGGGGGTTGGTCGACGAGCATCGTG
TTCGTTGCGCTGTTGTGTCTGCTGATCTGGTATGCAGCGCCCTTGCTGTCGTTCGGCCACACTTCGCCGT
TTGAACCCATTTCGGCCCGGATCGGCGCGATTGCGCTGGTGGTGGTGGTGTTCGCGCTGTTCTGGATGTT
CCGGCTTTGGCAGAAGATGCGAGAGGACGAGGCATTCCTGAAAAAAGTGCTTCGGTTCGGCGGCAAGACG
GAGGAATCCCCCGCAGCTCCGCGCCTGAAAAAGGTGGAGGCAATCGTCACGAGCGCACTGGCGCGGCTGA
AGTCGATGCGTACGGGGGCTCGAGGACCGGGCAAGCTGTTTCAGGGCAAGCGCTACCTGTACGAACTGCC
GTGGTACATCACGCTTGGTTCGCGAGGGGCGGGCAAGACGAGCGCGCTGCTCAACGGTGGTCTTGCATTC
CCGATCGCCGAGCAAATGCAGCGCGCGGCAGGGAAGTCGGCCAGTGATGCCGCGTCCGTGGACTGGTGGC
TCACCAACGACGCGGTGCTGATCGACACGGCTGGCTATTACACACGCCATGGCACGTCGACGGTGAAGGA
AGGTGAGGGGCTCGCTCCGTCATCGGATCGGCCAGCAACGGCTGCATCGAGTGAGGATAAAGCAGGCAAA
GACGGCGAAGAGAAGAAGGGCGACGCGTCAGGCGATACCCGGGCGGCGACACTTGCAAAGTCGAGCGCCA
ATATTGTTCCGATTCGGGCAGACTCGCCCGAGCAACGCGAAGCGCTTGATCGCGCGGAATGGTTGGGTTT
TCTCGGCATGCTGCGCCGCCACCGACCACGTGCCCCCATTAATGGCGCGCTGCTTGCCGTCGACCTTGAC
TCGCTGGTCGGCGCCGACGAGCAGAAGCGCCTCGCCGAGGCCTCGGCGCTGCGTGCGCGACTGGGCGAAC
TGCGCGGCGAGCTTGGTATTCGCTTCCCGGTGTACGTGCTCGTCACCAAGATGGACCGGTTAACGGGGTT
TGCGGAGTATTTCAGCGGGCTGACGGCCGAGAGCCGCGCGCAGGCGTGGGGTTTCACGTTGCCGTACGGC
AAGGAAACGGTCGCGAAGGAGGGCTTGCGTGCGCGCTGTCGTGATGAGCTGATGCAGATGGCGGGCCGGC
TGTCCGGCATGATTCACACGCGCCTGCAGGACGAGGACGAGACGCACAAGCGCCGCCAGCTCGCCGCGTT
GCCGGAGGAGTTCTCCGCGCTGGTCGGACCGCTCGTCGACCTGATCGATCGTGTGTTTCTCGACTCCCGT
TACGACGACACGCAGCTTCATTCGACGCTGCGGGGCGTCTACTTCACCAGCGCACAGCAGGACGGCCACT
CGGTCATCGCCGAACGCGACACGGTCGTGCAACGCCTCGCATCGAAGCAAGGGCAGGCAGGCGCCGCCGG
TGGGCATGAGGGCAATCGGAGCTACTTCTTGCACGACGTCCTGACCCGAGTCGTGTTTCCGGAAGCGCAT
CTCGTCAGTCCCAACTTGCGGTGGGAATACCGGTACCGGCTGCTGCGCCTGATTGGCCATGCGCTCGCCT
TGCTCCTATTCGTGTGGCTGGCACTCGGATTGCGCGTGAGCTTTGGCAACAACAGCGACTACCTCGACGT
CATCGGGCGCAAGGTCCAGGCGTTGGCGGCCCGCGTGACCCAGCTGTACAAGGAACCCAACCCGGAGGCC
GTGCCGGATACGCTGACCGAAGCGCGCTATTTGCCGACCTTTCCGAACCTGGACCTGTCAGATCCCGGCA
GCACATGGCGTTACGGCCTCTATACGCCACCGGACATCGTGACGGAGAGCGGTCATACCTACGATGCGCT
GGAGGACAACCTGCTGGTGCCGCAGATCGTGCGCCGGATGGAAAGCGTGATGTCCGGGGCGATCGCCAAC
AAGGATCCGAAGGCTGCTTACGATGCGCTGCGCGTGTACTTGATGCTTTACGACAAGGCAAAATTCAATG
CCGGCGACGTGAAGATTTGGGTGCTCGACGACTGGGCGAAAAACGACAGCGCGGCGGTTTTTGGCGGCCG
TGCGTCGATGATCGATCACGTCCAGCAACTCTTTTCGGGCGACCGCGTCGTAAAATCGCCGCTGATTCGC
AACGATGCGCTGATCCAGCAGGCACGGGCGTTTCTCGACGGTAGCAATGCAACCGATCGACTGTACCAGC
GCGCGAAGGCCGCGATGCTGAAGGAGTCTCCGGACGAGTTCACCTTGCTGCGCGCGGTCGGGCCGCAGGC
CGGTACGGTGTTCACGCGTGCCAGCGGCCAGCCGCTGTCGCGCGGCGTGCCGGGCCTGTTCACGTTCGAC
GGTTATCGGAACTTGTTCGATAAACGTCTCCCCGAGTTTGTCCAAATCGCGCGCGACGACGACGCATGGG
TGATGGGTCGCTCGTACCTGGGCGAGGCTCAAAAAAAAACTGCTGAAATCGTGAGCACTGTAACGGGCGC
GGACGATGCACTGACGGACGCGGTTCGCCGCCAGTATCTGCTGGAATATGCGCAGCAGTGGGATGCGTTT
CTCAACGACATCCGAACGGTGAGCGGCACGAGCCTCGCATTCAATCTCCAGGTGCTGCGCAGCTTCGCGG
CGCCCGACTCGCCGCTCGGACGACTTGCACGCGCGGCCGTGCGTGAAACGACGCTCACGGCGCCGGTGAC
CGCATCGGACGGGTCATTTCTGCAGAAGGCGGCCGACCAGCTCAACCAGAAGGCCGACAAGGCGCTCGGG
ATTCGCGCGTCCGAGCGCGTCGAGCGTGAATTGGTCGACAGCCATTTCGCAGCGCTTCGCGAGGTCGTGA
CGGGCAACGCCGATTCGCAGGTCGGCGCCCAAGCTGCCGCGGCCCAGGCCGGGAAGACGGGACTCGACGG
CGTGACGAACCTGTTGAACGATTACTACACGGCGCTCACGGTTTCCGACAACGCGTTGTCGAACAACAGC
ATGCCGCCGGCGAGCGACACGGCGGCGAAGCTCAAGATGACGGCTAACACGATGCCGGCACCTTTCCGGG
CAGTGTTGCTGCAACTTGCCGCGGACGGCTCGCACGAAGTCAATCAGGGGATCGGCCAGCTGCTGTCGCG
CCAGATGCAGGCAGTCGTCGGCGACACCTGCCGGCTTGCCATCGAAGGCAACTATCCGTTCTCGCCCGAC
AGCAAGCGCGACGTCAGCATCGACGACTTTACCCGTGTGTTCGCGCAGGGTGGCGTGATCGACGACTTCT
TTGGGAAGACACTTGCGCCGTTTGTCGACACCTCCGCGAAGCCGTGGCGCTACAAGACTCTGGCGGGCGC
GACGGAACCCGTGCAGGGACCGGATCTGGAGCCGTTCGAGCACGCGAAGGCGATCCGCGACGTGTTCTTT
AACGACCCGGGCCACAAGCAGCTCACGTGGAAGGCCGACATCCGTATTCCCGAACTGGATCCGACGATCA
CCAGCCTCTCGCTCGACATCGATGGCCAGACCTCGCTCTATCAGCATGGTCCGGTTGCGCCGTTTGCGGT
GACGTGGCCCGGGCCGCGCGGCGGTGTCCATACGGAGATCACCGCCAATCCTCGCATCCGTCCCGACACG
TCGACGATCGCGGCTGACGGTCCCTGGGCGCTGATGCGTCTGCTCCAGAAGGGGCAGGTGGTGGAAACCG
CCACGCCCGGGCGTACCCGGGTCGCCTTCGATTTCGATGGGCGCAAGGCGGTGCTCGATGTTGCGAGCAC
CGGGAGCGTGGCGAACCCGCTGACCAGCGATGTGCTGAAGACCTTCCGCTGTCCGAGTTCGATGCCGGTG
TTCAACCTGTCGGATAGCGGGCCGCCCCCAGGGCTGCCGCGCGGTACGACGCCGGCGAGCCCGGCCAATG
TCACCCAATAA
 Primer design