SecReT6
Protein ID: 330815350
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04060
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]446062..446847 [-]
ProductOmpA family protein
NoteTssL
UniProt IDF2LI22
KEGG IDbgd:bgla_1g04060
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|330815350|ref|YP_004359055.1| OmpA family protein [Burkholderia gladioli BSR3]
MSYAPSLFGGTTPPPAPHSASSTDASFQARSLLDLLYDGFFMMFLLKNGREPGEANEFRTRIQEFLADFE
RGAKKLNAGADDVYAAKFAFCAAIDEAVLSSQFKVRAEWERRPLQLVLFGEQLAGEKFFQYLEECRAHGV
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIAQMKGKRAPFAPHWALPDQIAHRLKREVPL
WAIGAVFALVGLLAFVGLNAYLRDHTLKALAPYSQIIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c446847-446062 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCTACGCGCCCTCCCTGTTCGGCGGCACCACGCCGCCCCCCGCCCCGCATTCGGCCTCGTCGACCG
ACGCCAGCTTCCAGGCGCGCTCGCTGCTCGACCTGCTCTATGACGGCTTCTTCATGATGTTCCTGCTGAA
GAACGGTCGCGAGCCCGGCGAGGCGAACGAGTTCCGCACGCGGATCCAGGAGTTCCTGGCCGATTTCGAG
CGCGGCGCGAAGAAGCTCAATGCCGGCGCCGACGACGTCTACGCCGCCAAGTTCGCGTTCTGCGCGGCGA
TCGACGAGGCGGTGCTGTCCTCGCAGTTCAAGGTGCGTGCCGAGTGGGAGCGCCGCCCGCTGCAGCTGGT
GCTGTTCGGCGAGCAACTGGCCGGCGAGAAGTTCTTCCAGTACCTGGAGGAATGCCGCGCGCACGGCGTG
GCGCGCCTGCAGTCGCTGGAGGTGTTCCACATGTGCCTGCTGCTGGGCTTCCAGGGCAAGTACCTGCTCG
AGGGACCGGAGAAGCTCGCCTACCTGACCGCGCGGATCGGCGACGAGATCGCCCAGATGAAGGGCAAGCG
CGCGCCCTTCGCGCCGCATTGGGCGCTGCCCGACCAGATCGCGCACCGCCTCAAGCGCGAGGTGCCGTTG
TGGGCAATCGGCGCCGTGTTCGCGCTGGTCGGCCTGCTGGCCTTCGTCGGGCTCAACGCCTATCTGCGCG
ATCACACGCTGAAGGCGCTGGCGCCCTATTCGCAGATCATCAAGGTCGGGCCGGAATCGGCCAACCTGAC
GATCTCGCTGCCCTGA
 Primer design