SecReT6
Protein ID: 330815351
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04070
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]446844..448190 [-]
Producthypothetical protein
NoteTssK
UniProt IDF2LI23
KEGG IDbgd:bgla_1g04070
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|330815351|ref|YP_004359056.1| hypothetical protein bgla_1g04070 [Burkholderia gladioli BSR3]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESLQAIQPYNWGVRSVKLDRDAISSNVLRLSELSLIFP
DGALYSAPQADDLPPPVALDTLPEGINDFTFYLALHPLREAGSNYVENAEGGFLSRFTSDNAPIADQFTD
AADADITFLKTNVKLIAHSEPRDQLLAIPLVRVRRTATSGFEFDDSFVPPCLAIEASGVLMQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFASLAHLYQHSALHPERLFQELLRLAGQLMT
FSKSYALADLPAYRHDDPGPPFARLDTMLRELLETVISTRYFAITLEEVRPSFHIGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQSQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c448190-446844 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGTGAAGGCCTGTTTCTGAGGCCGCAGCACTTTCAACGCCAGG
ACGCGTATCACGAGGCGCGCCTGTTCGAGTCGCTGCAGGCGATCCAGCCTTACAACTGGGGCGTGCGCTC
GGTGAAGCTCGACCGCGACGCGATCAGCAGCAACGTGCTGCGCCTGTCGGAGCTGTCGCTGATCTTCCCG
GACGGCGCGCTCTACTCCGCGCCGCAGGCTGACGACCTGCCGCCGCCGGTGGCGCTGGACACGCTGCCCG
AGGGCATCAACGATTTCACCTTCTACCTGGCCCTGCACCCGCTGCGCGAGGCCGGCTCGAACTACGTCGA
GAACGCCGAGGGCGGTTTCCTGAGCCGTTTCACCAGCGACAACGCGCCGATCGCCGACCAGTTCACCGAC
GCGGCCGACGCCGACATCACCTTCCTGAAGACCAACGTCAAGCTGATCGCCCACAGCGAGCCGCGCGACC
AGTTGCTGGCGATTCCGCTGGTACGGGTGCGCCGCACCGCCACCTCGGGTTTCGAGTTCGACGACAGCTT
CGTGCCGCCGTGCTTGGCTATCGAGGCCTCGGGGGTCCTGATGCAGCGGCTGCGCCAGCTGATCGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTACGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGACATCGCCTCGTTCTGGCTGCTGCACACGGCCAATGCCGCGTTCGCCTCGCTCGCCCACCTGTA
CCAGCATTCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTGGCCGGCCAGTTGATGACC
TTCTCGAAGTCCTACGCGCTGGCCGACCTGCCGGCCTACCGGCACGACGATCCGGGCCCGCCGTTCGCGC
GCCTGGACACCATGCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCCATCACGCTGGA
GGAGGTGCGGCCCTCGTTCCATATCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTGGCCGTGTCGGCCGACATGCCCTCGGTCGAGCTGGTCGACGCGGTGCCGGCGCGTTTCAAGGTCGGCG
CGCCCGACGATGTCGACAAGCTGGTGCTGTCGGCCATGCCGGGCGTACGCCTGTCCTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCGGGCGCCTGCTACTTCGCGCTCGATGCGCGCAGCCCGCTGTATGAA
CGGATGCTGCAATCGCAATCGGCGATGATCTACGCGCCCTCGGGCATCAACGACCTCAAATTCGAACTGA
TCGCCGTCACATCATGA
 Primer design