SecReT6
Protein ID: 330815352
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04080
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]448291..448908 [-]
ProductPutative lipoprotein
NoteTssJ
UniProt IDF2LI24
KEGG IDbgd:bgla_1g04080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.80E-37, Aligned region: 15..176
Protein Sequence: 205 a.a.     [Download]
>gi|330815352|ref|YP_004359057.1| Putative lipoprotein [Burkholderia gladioli BSR3]
MTPSFPRFALPLVACALLAGCAAAVPLLGSAGSTALQMVGLGKPEVPDAQKPPRNLGITLYAAPNLNAAN
DNKPLALVVRLYTLKDPTSFQQAPFDTFTDPAKEKAALGADLLGVREVTLIPGQRYNATEKVSREAQAFG
IVALFRSPALQRWKLAFDPAKSEKSGIIIGLHNCAMTVTDGSVIASQQGMPAQQLNMLSSVSCGN
 
Nucleotide Sequence: 618 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c448908-448291 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGACTCCGTCCTTTCCCCGCTTCGCGCTGCCGCTCGTGGCCTGCGCCTTACTGGCAGGCTGCGCGGCGG
CCGTGCCGCTGCTCGGTTCGGCCGGCAGCACGGCCCTGCAGATGGTCGGCCTCGGCAAGCCCGAGGTGCC
CGATGCGCAGAAGCCGCCGCGCAATTTAGGCATTACCCTCTACGCGGCGCCGAACCTCAACGCGGCCAAT
GACAATAAGCCGCTGGCGCTGGTGGTGCGGCTCTACACGCTGAAGGACCCGACCTCGTTCCAGCAAGCGC
CGTTCGACACCTTCACCGATCCGGCCAAGGAGAAGGCCGCGCTCGGCGCCGACCTGCTCGGCGTGCGTGA
GGTCACCCTGATCCCGGGGCAGCGCTACAACGCCACCGAGAAGGTCTCGCGCGAGGCGCAGGCGTTCGGC
ATCGTCGCGCTGTTCCGCAGCCCAGCGCTGCAGCGCTGGAAGCTGGCCTTCGATCCGGCGAAATCGGAGA
AATCCGGCATAATCATCGGCCTGCACAACTGTGCGATGACCGTGACGGATGGCAGCGTGATTGCGTCGCA
GCAGGGTATGCCGGCCCAGCAGCTGAATATGCTCTCATCAGTCAGCTGCGGTAATTAA
 Primer design