SecReT6
Protein ID: 330815354
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04100
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]449990..450508 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2LI26
KEGG IDbgd:bgla_1g04100
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-58, Aligned region: 11..163
Protein Sequence: 172 a.a.     [Download]
>gi|330815354|ref|YP_004359059.1| hypothetical protein bgla_1g04100 [Burkholderia gladioli BSR3]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVGDLAGQSEVEMPKLRDRKFVNIDRDNF
DDVMKAIEPRAAYQVENKLSEEGGKFAVDLKFRSLDDFDPDQVVNQIEPLRRLIEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLQALAKQSGGGDKEGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|330814956|ref|NC_015381.1|:449990-450508 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGGCGAAAAAAGAAAGTATCCAGAAGCGCCTGCAAAAGGTACGGCCGCCCCGTGTGCAGCTGACCTACG
AAGTCGAGCGCGGCGACGCGATCGAGGTGAAGGAACTGCCGTTCGTGGTCGGCGTGGTCGGCGACCTGGC
CGGTCAGTCCGAGGTCGAGATGCCGAAGCTGCGCGACCGCAAGTTCGTCAACATCGATCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCTCGCGCGGCCTACCAGGTCGAGAACAAACTCAGCGAGGAAGGCG
GCAAGTTCGCCGTCGACCTCAAGTTCCGCTCGCTCGACGATTTCGATCCGGACCAGGTGGTCAACCAGAT
CGAACCGCTGCGCCGCCTGATCGAGGCGCGCTCGAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTCGAGGACCTGCTGAGCGAAGTGCTCAGCAACACGCAGCAGTTGCAGGCGCTCGCGAAGCAGT
CGGGCGGCGGCGACAAAGAGGGCGAATAA
 Primer design