SecReT6
Protein ID: 330815355
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04110
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]450524..452014 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2LI27
KEGG IDbgd:bgla_1g04110
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|330815355|ref|YP_004359060.1| hypothetical protein bgla_1g04110 [Burkholderia gladioli BSR3]
MNQQTAAAQQAGALEGAETSLLDEIVEKSKVAKSQSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISAQMSAVMHAPEFQKLEGTWRGLDYLVSESNTGSTIKIKALHAPKRELVRDFKAATEFDQSA
LFKKVYEEEFGTFGGAPFGALVGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASAAPELIGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFHPKDGQTAESFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYNTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ESFLNRWISQYVLLDDNATQEQKAQFPLREASVQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKSANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|330814956|ref|NC_015381.1|:450524-452014 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAATCAGCAAACGGCTGCGGCCCAACAGGCCGGTGCGCTCGAGGGCGCCGAAACCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCGCAATCGGAGCACGCGCGCGCCAAGGACCTGATCGGCGA
ACTCGTGCATCAAGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTCTCGGCGACCATCGACGCGCGC
GTCGCCGAACTCGACCGGCTCATTTCCGCGCAGATGAGCGCGGTGATGCATGCGCCGGAATTCCAGAAGC
TCGAGGGCACCTGGCGCGGCCTCGACTACCTGGTCTCGGAGAGCAATACCGGCTCGACCATCAAGATCAA
GGCCCTGCACGCGCCCAAGCGCGAGCTGGTGCGCGACTTCAAGGCCGCCACCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGCGCCCCGTTCGGCGCGCTGGTCGGCG
ATTACGAAATATCGCGCCAGCCCGAGGACATGTACTTCATCGAGCAGATGTCGCACGTGGCCGCGGCCGC
GCACGCGCCCTTCATCGCCTCGGCCGCGCCCGAGCTGATCGGCCTGGAGTCGTTCGCCGACCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGATACCGTTGAGTACGCGAAGTGGAAGTCGTTCCGCGACGCCGAGG
ATTCGCGCTACGTGGGCCTCACGCTGCCGCGCTTCCTGGGCCGCCTGCCGTTCCATCCGAAGGACGGCCA
GACCGCCGAGAGCTTCAACTTCGTCGAGGACGTGGACGGCACCGACCACTCCAAGTACCTGTGGTGCAAC
GCCGCCTGGGCGTTCGCGGCGCGCCTGACGGCCGCCTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTGGAGGGCGGGGGGCTGGTGGAAGACCTGCCGACCCACACCTTCAAGACCGACGACGGCGAGATCGC
GCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGTCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTGGTGCACTGCAAGAACTCCGACTATGCGGCCTTCTTCGCCGCGCAATCGGTCCAGAAACCCAAAA
AATACAATACCGATAGCGCGAATGCGAACGCCGTGCTGTCCGCTCAACTCCAGTACATCTTCTCGGTGTC
GCGCATCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCCTCCGCGCAGAACGTG
GAATCTTTCCTGAATCGCTGGATCTCCCAGTACGTGCTGCTGGACGACAACGCGACGCAGGAACAGAAAG
CGCAGTTTCCGCTGCGCGAAGCATCCGTGCAGGTGTCCGAGATTCCGGGCAAGCCGGGTTCGTATCGTTC
GGTCGCGTTCCTGCGTCCGCACTTCCAACTCGACGAGCTGTCGATCTCGCTGCGCCTGGTCGCGGATCTG
CCCAAATCGGCAAATTCATAA
 Primer design