SecReT6
Protein ID: 330815356
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04120
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]452091..452594 [+]
Productputative hemolysin-coregulated protein
NoteTssD
UniProt IDF2LI28
KEGG IDbgd:bgla_1g04120
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.80E-45, Aligned region: 5..139
Protein Sequence: 167 a.a.     [Download]
>gi|330815356|ref|YP_004359061.1| putative hemolysin-coregulated protein [Burkholderia gladioli BSR3]
MLDIYLNFGNPAIKGESQDKDHANWIELKSWDWSVTQPRSATSSTSGGHTAERCEHSDMVFTKELDMASP
LLYQHASGGTTFDEVSIDFMRSDGEGKRVKYLEIKLKYVIISSVTPSVQTEGLPVEQFSLKYAAVQWKQT
KQNIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|330814956|ref|NC_015381.1|:452091-452594 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGTTAGATATCTATCTGAATTTCGGGAATCCGGCGATCAAGGGCGAATCGCAGGACAAGGACCACGCCA
ACTGGATCGAGCTCAAGTCCTGGGACTGGTCGGTCACGCAACCGCGTTCGGCCACCTCGTCGACCTCGGG
CGGCCACACGGCCGAGCGTTGCGAACACAGCGACATGGTGTTCACCAAGGAACTCGACATGGCCAGCCCG
CTGCTGTACCAGCACGCGTCGGGCGGCACCACCTTCGATGAAGTCTCGATCGACTTCATGCGTTCGGACG
GCGAAGGCAAGCGCGTCAAGTACCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCGTCACGCCGAG
CGTGCAGACCGAAGGCCTGCCGGTCGAGCAGTTCTCGCTGAAGTACGCTGCCGTGCAGTGGAAGCAGACC
AAGCAGAACATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design