SecReT6
Protein ID: 330815357
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04130
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]452683..453165 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2LI29
KEGG IDbgd:bgla_1g04130
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.00E-21, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|330815357|ref|YP_004359062.1| hypothetical protein bgla_1g04130 [Burkholderia gladioli BSR3]
MKRFEPSFLDKLFDDEPHQPASPAMRQLSLDELKSTVARDVESILNTRIALTDEDLHALPECQQSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIDRHEPRLRQVAVSFELNEQSTNSLNFAIRAMLVVHPAQEPVSFD
AMLQPSTLQYSVTRGRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|330814956|ref|NC_015381.1|:452683-453165 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAAACGTTTCGAGCCGAGTTTCCTCGACAAGCTGTTCGACGACGAACCGCATCAGCCGGCCTCGCCCG
CGATGCGGCAATTGTCGCTGGACGAGCTGAAAAGCACGGTCGCCCGCGATGTCGAGTCGATCCTGAACAC
GCGCATCGCCCTGACCGACGAAGATCTCCATGCGCTGCCGGAATGCCAGCAATCGGTGCTGACCTACGGC
CTCAACGATTTCGCGGGCCTCAGCCTCGCGAGCCACTACGACCGCGCCTTCATCTGCAAGTCGATCCAGC
AGGCGATCGACCGGCACGAGCCGCGCCTGCGGCAGGTGGCGGTATCGTTCGAACTGAACGAGCAATCCAC
CAATTCGCTGAATTTCGCGATTCGCGCGATGCTGGTCGTGCATCCGGCGCAGGAGCCCGTCAGTTTCGAC
GCGATGCTGCAGCCGTCCACATTGCAGTACTCGGTGACGCGCGGACGCGCCGCCAAGGTTTGA
 Primer design