SecReT6
Protein ID: 330815358
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04140
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]453243..455081 [+]
Producthypothetical protein
NoteTssF
UniProt IDF2LI30
KEGG IDbgd:bgla_1g04140
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.00E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|330815358|ref|YP_004359063.1| hypothetical protein bgla_1g04140 [Burkholderia gladioli BSR3]
MEELLPYYERELSFLRRYSHEFARRYPKIAARLAMTGEHCDDPHVERMIESFALLGARINKKLDDDYPEF
TEALVDVLYPHYLRSFPSCSIAQFTPSANVSQQTAPHRVARGTELKSRAIRGVQCQFRTAYDVTIAPIRI
SEARYSSIAAAPAATVLPGNATGVISITFESMAPQFDLAGLKLPTLRAHLHGEQSFVAALADCLFINTLA
TYVEPERNGRWTALRSSPVTQAGFEEHDALIDYPSRSHPAYRLLTEYFAFPDKFDFVDFDLAAMTRRAGP
CHRLTLHIVLADVRSDSHVARLLDMLSATHLRLFCTPVVNLFKQNGEPIRIDHQSVSYPVIAEARRAFAY
EVYSIDSVHLVRQTAHEESVVEFRPFYSLHHGEAGHVGHYWFARRNDWVAQHSPGYETEISIVDIDFEPS
APQTDTLSLRLTCTNRDLPAGLATGLAGGDLFADGGADFGDITMLRRPSPSVRFARGRAAHWRLISHLAL
NHVSLANDGLAPLKELLTLYDLRRSAVSTRHIDGLVAIEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLASFVRMLDAFFGLYVHLNSFVQLIVVSKRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|330814956|ref|NC_015381.1|:453243-455081 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGGAAGAGTTGCTGCCGTACTACGAGCGCGAATTATCGTTTTTACGGCGGTACTCGCACGAATTCGCCC
GACGCTACCCGAAGATCGCCGCGCGCCTGGCGATGACCGGCGAGCATTGCGACGACCCGCACGTCGAGCG
CATGATCGAGTCCTTCGCGCTGCTGGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCGGAATTC
ACCGAGGCGCTGGTCGACGTGCTGTATCCGCACTACCTGCGCTCGTTCCCGTCCTGTTCGATCGCGCAGT
TCACACCGAGCGCCAACGTCTCGCAGCAGACCGCGCCGCATCGGGTGGCGCGCGGCACCGAGCTGAAGAG
CCGCGCGATCCGCGGCGTGCAATGCCAGTTCCGCACCGCCTACGACGTGACGATCGCGCCGATCCGCATC
TCCGAGGCGCGCTATTCCTCGATCGCCGCCGCGCCGGCCGCCACCGTGCTGCCCGGCAACGCCACCGGCG
TGATCTCGATCACCTTCGAATCGATGGCGCCGCAGTTCGACCTGGCCGGGCTCAAGCTGCCGACGCTGCG
CGCCCACCTGCACGGCGAGCAGTCCTTCGTCGCCGCGCTGGCCGACTGCCTGTTCATCAACACGCTCGCC
ACCTATGTCGAGCCCGAGCGCAACGGCCGCTGGACCGCGCTGCGCAGCTCGCCCGTCACCCAGGCCGGCT
TCGAGGAGCATGACGCGCTGATCGACTACCCGTCGCGCTCGCACCCGGCCTACCGCCTGCTGACCGAATA
CTTCGCGTTCCCCGACAAGTTCGACTTCGTCGATTTCGACCTGGCCGCGATGACGCGCCGCGCCGGCCCC
TGCCACCGCCTGACCCTGCACATCGTGCTGGCCGACGTGCGCAGCGACTCGCACGTGGCGCGGCTGCTCG
ACATGCTGAGCGCGACCCACCTGCGCCTGTTCTGCACGCCGGTGGTCAACCTGTTCAAGCAGAACGGCGA
GCCGATCCGCATCGACCACCAGAGCGTCTCCTACCCGGTGATCGCCGAGGCGCGCCGCGCCTTCGCCTAC
GAGGTCTATTCGATCGATTCGGTGCACCTGGTGCGCCAGACCGCGCACGAGGAGTCGGTGGTCGAGTTCC
GGCCCTTCTATTCGCTGCACCATGGCGAGGCCGGGCATGTCGGCCATTACTGGTTCGCGCGCCGCAACGA
CTGGGTGGCCCAGCACAGCCCCGGCTACGAGACCGAGATCTCGATCGTCGACATCGACTTCGAGCCTTCC
GCGCCGCAGACCGACACGCTGAGCCTGCGCCTGACCTGCACCAACCGCGACCTGCCGGCGGGGCTGGCCA
CCGGCCTGGCCGGCGGCGACCTGTTCGCCGACGGCGGCGCCGATTTCGGCGACATCACGATGCTGCGCCG
GCCCAGCCCCAGCGTGCGTTTCGCGCGCGGGCGCGCCGCCCACTGGCGGTTGATCTCGCACCTGGCGCTG
AACCACGTGTCGCTGGCCAACGACGGCCTGGCGCCGCTCAAGGAACTGCTCACGCTCTACGACCTGCGCC
GTTCGGCGGTCTCGACCCGGCATATCGACGGGCTGGTGGCGATCGAGCAGCGCGGCGCCGTGCAATGGCT
ACCCGGCAAGCCCTTCGCGACCTTCGTGCGCGGTATCGAGATCCGCCTGACGATCGACGAGGAGCATTTC
GTCGGCACCAGCCTGGCGTCCTTCGTGCGGATGCTCGACGCCTTCTTCGGCCTCTACGTCCACCTCAACA
GCTTTGTCCAATTGATCGTCGTGTCCAAGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG
 Primer design