SecReT6
Protein ID: 330815359
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04150
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]455045..456142 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2LI31
KEGG IDbgd:bgla_1g04150
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-94, Aligned region: 18..346
Protein Sequence: 365 a.a.     [Download]
>gi|330815359|ref|YP_004359064.1| hypothetical protein bgla_1g04150 [Burkholderia gladioli BSR3]
MQTAQRRIDPGVVEQFLDEPYRFEFFQAVRLLETWFARRDPEKPDALRPGEIVERRVLFRNSLSLGFPPS
EIERAQSFDAAGERVDEEAHRAAVEDEQVDRVEIVPAFFGLLGGQGALPHHYTEQIIAREQLKRDHAARA
FFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLSLAGVSNPDARRAMQEGKGAVIDEAIAGYAL
AARHRPVSAAYLQRTLSDYFQVSIRVDQFVGKWYDVPPDQLSVLGEVNATLGATALVGERVWQRDMRARL
VVGPLSKRDYEAFLPGGDRAIALERMLTLLAGITLEYEISLVLKRVEVGPTILGSGGRLGWDAFLCTHEA
ERDRADARYELHVIH
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|330814956|ref|NC_015381.1|:455045-456142 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCAGTTCCTCGACGAGCCGTATCGCTTCG
AGTTCTTCCAGGCGGTGCGGCTGCTCGAAACCTGGTTCGCCCGGCGCGATCCGGAGAAGCCCGACGCGCT
GCGCCCCGGCGAGATCGTCGAGCGGCGGGTGCTGTTCCGCAACTCGCTGTCGCTCGGTTTCCCGCCCAGC
GAGATCGAGCGCGCGCAGTCCTTCGACGCGGCCGGCGAGCGGGTGGACGAGGAGGCGCATCGCGCCGCCG
TCGAGGACGAGCAGGTCGACCGCGTCGAGATCGTGCCGGCCTTCTTCGGGCTGCTGGGCGGGCAGGGCGC
ACTGCCGCATCACTACACCGAGCAGATCATCGCGCGCGAGCAGTTGAAGCGCGACCACGCCGCGCGCGCC
TTCTTCGACGTGTTCTCGAACCGCGCCACCGCGCTGTTCTATTCGGCCTGGAAGAAGTACCGCCTGCCCC
TGCATTACGAGCTCGACCGCGACGAGCGCTACCTGCCGCTGCTGCTGTCGCTGGCCGGCGTGTCGAATCC
CGACGCGCGGCGCGCCATGCAGGAAGGCAAGGGCGCGGTGATCGACGAGGCCATCGCCGGTTACGCGCTG
GCCGCGCGCCATCGGCCGGTATCGGCCGCCTACCTGCAGCGCACCTTGTCGGACTATTTCCAGGTGTCGA
TCCGCGTCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGACCAGTTGAGCGTGCTGGGCGAGGT
CAATGCCACGCTGGGCGCGACCGCGCTGGTCGGCGAGCGGGTCTGGCAGCGCGACATGCGCGCCCGGCTG
GTGGTGGGGCCGCTGTCCAAGCGCGACTACGAGGCCTTCCTGCCCGGCGGCGATCGCGCCATCGCGCTGG
AGCGCATGCTGACGCTGCTGGCCGGCATCACGCTCGAATACGAAATCTCGCTGGTGCTCAAGCGCGTCGA
GGTCGGCCCGACCATCCTCGGCAGCGGCGGGCGGCTCGGCTGGGACGCCTTCCTCTGCACCCACGAGGCC
GAGCGCGACCGCGCCGATGCGCGCTACGAACTGCATGTGATCCATTGA
 Primer design