SecReT6
Protein ID: 330815360
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04160
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]456219..458894 [+]
ProductClpA/B type protease
NoteTssH
UniProt IDF2LI32
KEGG IDbgd:bgla_1g04160
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 233..330
AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 621..789
AAA [PF00004], Evalue: 9.20E-19, Aligned region: 234..347
AAA [PF00004], Evalue: 9.20E-19, Aligned region: 626..743
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 234..254
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 308..364
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 625..746
ClpB_D2-small [PF10431], Evalue: 4.40E-12, Aligned region: 571..585
ClpB_D2-small [PF10431], Evalue: 4.40E-12, Aligned region: 796..867
Clp_N [PF02861], Evalue: 2.30E-11, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.30E-11, Aligned region: 113..133
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 57..84
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 211..255
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 278..312
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 503..538
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 606..646
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 692..714
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 791..835
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 234..320
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 353..394
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 687..719
Sigma54_activat [PF00158], Evalue: 3.40E-06, Aligned region: 216..250
Sigma54_activat [PF00158], Evalue: 3.40E-06, Aligned region: 623..744
AAA_17 [PF13207], Evalue: 8.20E-05, Aligned region: 67..105
AAA_17 [PF13207], Evalue: 8.20E-05, Aligned region: 235..302
AAA_17 [PF13207], Evalue: 8.20E-05, Aligned region: 625..661
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 621..651
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 225..253
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 625..643
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 232..260
AAA_19 [PF13245], Evalue: 0.00046, Aligned region: 622..647
SRP54 [PF00448], Evalue: 0.00068, Aligned region: 234..254
SRP54 [PF00448], Evalue: 0.00068, Aligned region: 435..482
SRP54 [PF00448], Evalue: 0.00068, Aligned region: 624..657
Zeta_toxin [PF06414], Evalue: 0.00078, Aligned region: 233..254
Zeta_toxin [PF06414], Evalue: 0.00078, Aligned region: 615..665
NACHT [PF05729], Evalue: 0.0014, Aligned region: 234..261
NACHT [PF05729], Evalue: 0.0014, Aligned region: 626..646
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 213..248
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 286..330
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 623..664
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 696..719
AAA_14 [PF13173], Evalue: 0.002, Aligned region: 236..367
AAA_14 [PF13173], Evalue: 0.002, Aligned region: 624..706
MobB [PF03205], Evalue: 0.0074, Aligned region: 235..253
MobB [PF03205], Evalue: 0.0074, Aligned region: 624..657
Protein Sequence: 891 a.a.     [Download]
>gi|330815360|ref|YP_004359065.1| ClpA/B type protease [Burkholderia gladioli BSR3]
MSTPLKTLIAKLNPTCRKAAERAASLCFARGHYEVDLEHLFVALLDETSGDMPVVLRASGVDPHALRADL
ERELESLKRGNTRTPVFSVHLSELFEQAWLIASLDAQIGRIRSGHLLLALLSAPDLAQFAQRMSPQFARV
RVTDLKHKFDEITAGSNEAEPREADAGAGDQTDVAAEAAAGAAGGPSKTPALDTYTTNLTQRAREGKIDP
VIGRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAAGDVPPPLAGVALHVLDMGLLQAGA
SVKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEY
KKYFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAGLMERHFNVRILDDAITEAVRLSHRYISGRQLPDK
AISVLDTACAKVALAQSATPAVIDDTSKRLERTDAEIASLEREVAGGASHEERLAVLRVAREADVAALET
ARRRYAEEQAVVAGIVALRARIDAAREGSAEGERIDEDAVRAELAERIAALAALQGVEPMVPLQVDGHVV
AEIVAAWTGIPLGRMVKDEIETVMNLNALLGARVIGQDHALDAVAQRVRTATAGLEDPNKPRGVFMFVGP
SGVGKTETALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLL
DEVEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSSQVMQACLNKPEEELPDPDALAET
LRPALYKAFKPAFLGRMKVVPYYPISDEVLVEIIELKLDRIRRRIEANHKAAFEWDESLVEAVLARCTEV
DSGARNVDHILNGTLLPEIAGHVLERLADGTALKRIAVRASEAGEFEYTVE
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|330814956|ref|NC_015381.1|:456219-458894 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCACGCCACTCAAGACCCTGATTGCGAAACTGAACCCGACCTGCCGCAAGGCGGCCGAACGCGCGG
CGAGCCTGTGTTTCGCGCGCGGCCACTACGAGGTCGATCTCGAGCACCTGTTCGTCGCGCTGCTCGACGA
GACCAGCGGCGACATGCCGGTGGTGCTGCGCGCCAGCGGCGTCGATCCGCATGCGCTGCGCGCCGACCTC
GAACGCGAGCTGGAGAGCCTCAAGCGCGGCAACACGCGCACGCCGGTGTTCTCGGTGCACCTGAGCGAGC
TGTTCGAGCAGGCCTGGCTGATCGCCTCGCTGGACGCGCAGATCGGGCGGATCCGCTCGGGTCACCTGCT
GCTCGCGCTGCTGAGCGCGCCCGACCTGGCGCAGTTCGCGCAGCGCATGTCGCCGCAGTTCGCGCGCGTG
CGCGTGACCGACCTCAAGCACAAGTTCGACGAGATCACGGCCGGCTCGAACGAGGCCGAGCCGCGCGAGG
CCGATGCCGGCGCCGGCGACCAGACCGACGTGGCGGCCGAGGCGGCGGCCGGCGCCGCGGGCGGCCCGTC
GAAGACGCCCGCGCTCGACACCTACACCACCAACCTCACGCAGCGCGCCAGGGAAGGCAAGATCGACCCG
GTGATCGGCCGCGACGCCGAGATCCGCCAGGCGATCGACATCCTGATGCGGCGCCGCCAGAACAACCCGA
TCATGACCGGCGAGGCCGGGGTCGGGAAGACCGCCGTGGTGGAAGGGCTGGCGCTGCGCATCGCCGCCGG
CGACGTGCCGCCGCCCTTGGCCGGCGTGGCGCTGCACGTGCTCGACATGGGCCTGCTGCAGGCCGGCGCG
AGCGTGAAGGGCGAGTTCGAGAACCGCCTGAAGAGCGTGATCGACGAGGTCAAGAAGAGCGCGCACCCGA
TCATCCTGTTCATCGACGAGGCCCACACCATCATCGGCGCGGGCGGCCAGGCCGGGCAGAACGATGCTGC
CAACCTGCTCAAGCCGGCACTGGCGCGCGGCGAGCTGCGCACCATCGCGGCCACCACCTGGAGCGAGTAC
AAGAAGTACTTCGAGAAGGATGCTGCCTTGGCGCGGCGCTTCCAGGTGGTCAAGATCGAGGAACCCAGCG
AGCCGCTGGCGGCCGCCATGCTGCGCGGCATGGCCGGGCTGATGGAGCGCCACTTCAACGTGCGCATCCT
CGACGACGCGATCACCGAGGCGGTGCGGCTCTCGCATCGCTACATCAGCGGCCGGCAACTGCCCGACAAG
GCGATCAGCGTGCTCGACACCGCCTGCGCGAAGGTCGCGCTGGCGCAGAGCGCGACGCCGGCCGTGATCG
ACGACACCAGCAAGCGCCTGGAGCGCACCGACGCCGAGATCGCCTCGCTGGAGCGCGAGGTGGCCGGCGG
CGCCTCGCACGAGGAACGGCTGGCGGTGCTGCGGGTGGCGCGCGAGGCCGATGTGGCCGCGCTGGAGACG
GCCCGGCGGCGTTATGCCGAGGAGCAGGCGGTGGTGGCCGGGATCGTCGCGCTGCGCGCGAGGATCGACG
CGGCGCGCGAGGGCTCGGCCGAGGGCGAACGCATCGACGAGGACGCGGTGCGCGCCGAGCTGGCCGAGCG
CATCGCCGCGCTGGCGGCCCTGCAGGGCGTCGAGCCGATGGTGCCGCTGCAGGTCGACGGCCACGTGGTG
GCCGAGATCGTCGCGGCCTGGACCGGTATCCCGCTCGGGCGCATGGTCAAGGACGAGATCGAGACCGTGA
TGAATCTCAATGCCCTGCTCGGCGCGCGCGTGATCGGCCAGGACCACGCGCTCGACGCGGTGGCGCAGCG
CGTGCGCACCGCCACCGCCGGGCTGGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCC
TCGGGCGTGGGCAAGACCGAGACGGCGCTGGCGCTGGCCGACGTGCTCTACGGCGGCGAGCGCAAGATGG
TCACCATCAACATGAGCGAGTACCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCGGGTTA
CGTCGGCTATGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCCGCAATCCCTATTCGGTGGTGCTGCTC
GACGAGGTCGAGAAGGCTCACCCGGACGTGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGCGATGG
ACGACGCCGAGGGCCGCGAGATCGACTTCCGCAACACCCTGATCATCCTGACCTCGAACGTCGGATCGAG
CCAGGTGATGCAGGCCTGCCTGAACAAGCCGGAAGAGGAGCTGCCGGACCCCGACGCGCTCGCCGAGACG
CTGCGCCCGGCGCTCTACAAGGCCTTCAAGCCGGCCTTCCTGGGCCGCATGAAGGTGGTGCCCTATTACC
CGATCTCGGACGAGGTGCTGGTCGAGATCATCGAGCTGAAGCTGGATCGCATCCGCCGCCGCATCGAGGC
CAACCACAAGGCCGCCTTCGAGTGGGACGAGTCGCTGGTGGAGGCGGTGCTGGCGCGCTGCACCGAGGTC
GATTCGGGCGCCCGCAACGTCGACCACATCCTCAATGGCACGCTGCTGCCCGAGATCGCCGGCCACGTGC
TGGAGCGGCTCGCCGACGGCACCGCGCTCAAGCGCATCGCGGTGCGCGCCAGCGAGGCCGGCGAATTCGA
GTACACGGTGGAGTAA
 Primer design