SecReT6
Protein ID: 330815361
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04170
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]459032..460186 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2LI33
KEGG IDbgd:bgla_1g04170
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.30E-23, Aligned region: 55..116
ImpA-rel_N [PF06812], Evalue: 5.30E-23, Aligned region: 203..222
Protein Sequence: 384 a.a.     [Download]
>gi|330815361|ref|YP_004359066.1| hypothetical protein bgla_1g04170 [Burkholderia gladioli BSR3]
MPIHVTALLAPLSEASPCGEDLLFSSEFDAIQHARKFDDPSLDQGEWITEIKEADWGFVVEQSVELLGTR
TKDLRLAVWLTEALAIQDGVGGLTQGYELLAGLVHTWWDQVHPLPEGDDAEYRLGNVGWLSGRTAELLRT
VALTDGSGSAYTALDWEVAQHVAQAVRRDPDNAHEISRNKPAVEQIEASKRMTSVAFYATLLAKLTAFRA
ALDALDDELERRAGNAAPSFRQAREAYESVRMLAERFAKEQGYVAEAQPVAPPPAQPGQGAPLERAEPSF
KTPLSPEPIALMPNVQPVQPVPVQVAAPTVIAGIQNRAQAVEQLRAVAKYFRATEPHSPVAYLADKAAEW
ADMPLHQWLASVVKDDGSLSHIRELLGLKPDENN
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|330814956|ref|NC_015381.1|:459032-460186 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGCCGATTCACGTCACCGCGCTTCTGGCGCCCCTCAGCGAGGCCTCGCCCTGCGGCGAAGACCTGCTGT
TCTCGTCCGAATTCGACGCGATCCAGCACGCGCGCAAATTCGACGATCCCTCGCTCGACCAGGGCGAATG
GATCACCGAAATCAAGGAAGCCGACTGGGGCTTCGTGGTCGAGCAGTCGGTCGAGCTGCTCGGCACGCGC
ACCAAGGACCTGCGCCTGGCGGTCTGGCTCACCGAGGCGCTGGCGATCCAGGACGGCGTGGGCGGGCTGA
CCCAGGGCTACGAGCTGCTGGCGGGGCTGGTGCATACCTGGTGGGACCAAGTGCATCCGCTGCCCGAGGG
CGACGACGCCGAATACCGGCTCGGCAATGTCGGCTGGCTGTCCGGGCGCACCGCCGAGCTGCTGCGCACC
GTCGCGCTGACCGACGGCTCGGGCAGCGCCTATACCGCGCTCGACTGGGAGGTGGCCCAGCACGTCGCGC
AGGCGGTACGGCGCGACCCCGACAATGCCCACGAAATCTCGCGCAACAAGCCCGCGGTGGAGCAGATCGA
GGCCTCCAAGCGGATGACCTCGGTGGCCTTCTACGCCACGCTGCTGGCCAAGCTGACGGCGTTCCGCGCC
GCGCTCGACGCGCTCGACGACGAGCTCGAGCGGCGCGCCGGCAATGCCGCGCCGAGCTTCCGCCAGGCGC
GCGAGGCCTACGAATCGGTGCGCATGCTGGCCGAGCGCTTCGCCAAGGAGCAGGGTTACGTGGCCGAGGC
GCAGCCGGTGGCGCCGCCGCCCGCGCAGCCCGGCCAGGGCGCCCCGCTCGAACGCGCCGAACCGAGCTTC
AAGACCCCGCTTTCCCCGGAGCCGATCGCACTGATGCCCAACGTCCAGCCCGTTCAGCCCGTCCCGGTCC
AGGTCGCCGCGCCGACCGTGATCGCCGGCATCCAGAATCGCGCGCAGGCCGTCGAGCAGTTGCGCGCCGT
CGCCAAGTATTTCCGCGCCACCGAGCCGCACAGCCCGGTCGCCTATCTCGCCGACAAGGCCGCCGAATGG
GCCGACATGCCGCTGCACCAGTGGCTGGCCTCGGTGGTGAAAGACGACGGCTCGCTGTCGCATATCCGCG
AGCTGCTGGGCCTGAAGCCCGACGAGAACAACTGA
 Primer design