SecReT6
Protein ID: 330815362
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04180
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]460280..461317 [-]
ProductOmpA/MotB protein
NoteTagL
UniProt IDF2LI34, F2LI34
KEGG IDbgd:bgla_1g04180
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 8.20E-25, Aligned region: 178..233
OmpA [PF00691], Evalue: 8.20E-25, Aligned region: 243..337
BON [PF04972], Evalue: 0.00021, Aligned region: 116..154
BON [PF04972], Evalue: 0.00021, Aligned region: 191..210
BON [PF04972], Evalue: 0.00021, Aligned region: 270..282
Pilus_CpaD [PF09476], Evalue: 0.00057, Aligned region: 238..324
Protein Sequence: 345 a.a.     [Download]
>gi|330815362|ref|YP_004359067.1| OmpA/MotB protein [Burkholderia gladioli BSR3]
MTTSAYRRRLLPAALSTLSLLALGAALAGPGVAFADNAGPATVTRVDTSGVTVRTTLIPPAGGAMQPAAA
GALGGTAQGGTVLTGTNVANGAGSGQATGAGTGATVSAPAPANATPGQVVAGGKVPDEATKAAVLQKLRD
TYGAGNVVDQIEVGDVTTPPNWSANVQKLIGPQLKQISKGQLKIDGTSIDVRGEVRNEALRQQVASDMAN
QLNPTYTIRNALRVSASEQGILDQTLANRTIEFETGSATLTPQGRAILDQMADAMSKLANRQVTIIGHTD
NSGNRATNISLSQARADAVKGYLVAKGIASQQLTTTGVGPDQPIASNDTADGRARNRRIEFRVSQ
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c461317-460280 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGACGACCTCCGCGTACCGCCGGCGCCTGCTGCCGGCCGCGCTTTCCACGCTGTCCCTGCTGGCGCTTG
GCGCGGCGCTCGCCGGCCCCGGCGTCGCCTTCGCCGACAACGCGGGCCCCGCCACCGTCACGCGCGTCGA
CACCAGCGGCGTGACGGTGCGCACCACCCTGATCCCGCCGGCCGGCGGCGCCATGCAGCCGGCCGCGGCC
GGCGCGCTGGGCGGCACCGCCCAGGGTGGCACGGTACTGACCGGCACCAATGTCGCGAACGGCGCGGGCA
GCGGCCAGGCCACCGGCGCCGGCACCGGCGCGACCGTGTCGGCCCCGGCGCCGGCCAATGCCACGCCGGG
CCAGGTGGTGGCCGGCGGCAAGGTGCCCGACGAGGCCACCAAGGCGGCCGTGCTGCAGAAGCTGCGCGAC
ACCTACGGCGCCGGCAACGTGGTCGACCAGATCGAGGTGGGCGACGTCACCACCCCGCCGAACTGGAGCG
CCAACGTGCAGAAGCTGATCGGCCCGCAACTGAAGCAGATCAGCAAGGGACAGCTGAAGATCGACGGTAC
CTCGATCGACGTGAGGGGCGAGGTCCGCAACGAGGCGCTGCGCCAGCAGGTGGCCAGCGACATGGCCAAC
CAGCTGAACCCGACCTACACGATCCGCAACGCGCTGCGCGTGAGCGCCTCCGAGCAGGGCATCCTCGACC
AGACGCTGGCCAACCGCACCATCGAGTTCGAGACCGGCAGCGCCACGCTGACCCCGCAGGGCCGCGCGAT
CCTGGACCAGATGGCCGACGCGATGAGCAAGCTGGCGAACCGGCAGGTCACCATCATCGGCCACACCGAC
AACTCGGGTAACCGTGCCACCAACATCTCGCTGAGCCAGGCGCGCGCCGATGCGGTGAAGGGCTACCTGG
TGGCCAAGGGCATCGCCTCGCAGCAGTTGACCACCACCGGCGTGGGACCGGACCAGCCGATCGCCTCGAA
CGACACCGCCGACGGGCGGGCGCGCAACCGCCGCATCGAGTTCCGCGTCAGCCAGTAA
 Primer design