SecReT6
Protein ID: 330815364
SecReT6 ID433
T6SS typei4b
Gene symbol-
Locus tagbgla_1g04200
StrainBurkholderia gladioli BSR3
Repliconchromosome I [GenBank: NC_015381] [Browse all T6SS(s) in this replicon]
Location [Strand]462305..466180 [-]
Producthypothetical protein
NoteTssM
UniProt IDF2LI36
KEGG IDbgd:bgla_1g04200
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.80E-70, Aligned region: 192..453
IcmF-related [PF06761], Evalue: 1.50E-53, Aligned region: 497..849
DUF1215 [PF06744], Evalue: 3.50E-29, Aligned region: 982..1097
Protein Sequence: 1291 a.a.     [Download]
>gi|330815364|ref|YP_004359069.1| hypothetical protein bgla_1g04200 [Burkholderia gladioli BSR3]
MQRILNVLTHPRTLSILGFIALAAILFIVADALAISFVYPLAILAVIVVLWLLVKLIKRLRVRRANRKLG
DMLEEQAQVDKAAAASVTPVEPAKAAELDTLRARLVDTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAA
GKSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWIGFLGLLKKFR
PKAPINGIIVTASIAELTGSRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSSD
RQEYDRVWGATLPYEPDEKRDVVALFDERFEELYDGLKEISVAQLSISRGNILSPGQLSFPLEFASIKPT
LRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIASRFALDGSALPKPHSAFSKNGFFLRDL
FSKVIFEDRKTVRQFASPAKTRMRYATFFAFVAVLALALGGWTWSTIGNQQLVANVQADLDNIAKLEQNR
NDLQSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGDRLEERLLTEYYNGVRQIMLAPVADNLAAFLK
DVDAHPDQLAPMTRTPESGAVPVSDKSALQPQAQGGLYNDASPTNVEDAYNALKTYLMLSDKRHVEQAHL
TDQIARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVQDNDWPMIDANLALVDQTRENLRHVVRGMPA
RQRVYEEIKARASTRYAPMTIARIVGEDNTGLVAGSYAIPGTFTRDAWFDYVQPAIRDAATKELQAKDWV
LNTASQDDLTLEGSPEQIQKVLVGMYKTEYAQHWQKFMQGIAVQNFGSFGQAVDAMNKLGDPQDSPIRKV
LETAYDQTSWDNPSLANVSIKKAQTGVVNWVKQWFSRKPGGQLAANIDINGNPVEVPMGPIGQEFIGLGR
IVQTHDGGQSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLKYVDEQMLTGLT
DSQRKSLRPLLVRPLQQAFSVVIQPASVEVNKVWNAQVYQPFQASLANKYPFSAGAKVEAASSEIAQVFG
PDGSISKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPEFTSGFATWVAPLAGGAATSAASSEPQTVFQI
LPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPSGSPGATLTATTFDGRTLTLVNEPGRYGLEKLI
NSAQRSRRPDGTFDLAWTQGNVNVAVTMRIISTSQPSGGGSGGGDAPQQQSLRGLHLPSSVANTSASGAV
NATAQAPAGTSGVATAANGAAANASNAQGAQ
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c466180-462305 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGTTGACTCACCCGCGCACGCTCTCGATCCTCGGGTTCATCGCGCTCGCCG
CGATCCTGTTCATCGTGGCGGACGCCCTTGCGATCAGCTTCGTCTACCCGCTCGCGATCCTCGCGGTGAT
CGTGGTGCTGTGGCTGCTGGTGAAGCTGATCAAGCGGCTGCGCGTGCGGCGCGCCAACCGCAAGCTCGGC
GACATGCTCGAGGAGCAGGCCCAGGTCGACAAGGCGGCGGCCGCCTCGGTGACGCCGGTCGAACCGGCCA
AGGCCGCCGAGCTCGACACGCTGCGCGCGCGCCTGGTGGACACGGTCAAGACCATCAAGACCTCGAAGAT
CGGCCAGGTATCCGGCGGCTCGGCGCTCTACGAGCTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCG
GGCAAGAGCAGCGCGGTGATCAACTCGGGCCTGCAGTTCCCGTTCGCCGACAAGAACAGCGCGGTGATCC
ACGGCATCGGCGGCACCCGCAACTGCGACTGGTTCTTCACCACCGAGGGCATCCTGCTCGACACCGCCGG
CCGCTACTCGGTGCACGAGGAAGACCGCAGCGAATGGATCGGCTTCCTCGGCCTGCTCAAGAAATTCCGT
CCCAAGGCGCCGATCAACGGCATCATCGTCACCGCCAGCATCGCCGAGCTGACCGGCAGCCGTCCCGAGT
TCGCCATCAACCTGGCCAAGAACCTGCGCCAGCGCGTGCAGGAGCTGACCGAGAAGCTGGAGGTGTTCGC
GCCGGTCTACGTGATGTTCACCAAGGCCGACCTGATCACCGGCTTCACCGAGTTCTTCAGCAGCAGCGAC
CGCCAGGAATACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGAGAAGCGCGACGTGGTGG
CGCTGTTCGACGAGCGCTTCGAGGAACTCTACGACGGCCTCAAGGAAATCAGCGTCGCGCAACTGTCGAT
CAGCCGCGGCAACATCCTCTCGCCGGGCCAGCTGAGCTTCCCGCTCGAATTCGCCTCGATCAAGCCGACC
CTGCGCGCCTTCCTGGCCACCCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCT
ACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAATTCCGCCGCCGCGCAGCGCATCGCCTCGCGCTTCGC
GCTGGACGGCAGCGCCCTGCCCAAGCCGCACAGCGCCTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTG
TTCTCGAAGGTGATCTTCGAGGACCGCAAGACGGTGCGCCAGTTCGCCAGCCCCGCCAAGACGCGGATGC
GCTACGCCACCTTCTTCGCCTTCGTGGCGGTGCTGGCGCTGGCGCTGGGCGGCTGGACCTGGTCGACGAT
CGGCAACCAGCAGCTGGTGGCCAACGTGCAGGCCGACCTCGACAACATCGCCAAGCTCGAGCAGAACCGC
AACGACCTCCAATCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGCATCGAGCAGCTCGAGCAGTTCC
GCCGCGACAAGCCGCTCTCGGTCTCGCTGGGCCTCTACCAGGGCGACCGCCTGGAAGAGCGCCTGCTCAC
CGAGTACTACAACGGCGTGCGCCAGATCATGCTGGCGCCGGTGGCCGACAATCTCGCCGCCTTCCTGAAG
GACGTCGACGCGCATCCGGACCAGCTCGCGCCGATGACGCGCACGCCCGAATCGGGCGCGGTGCCGGTCT
CCGACAAATCGGCGCTGCAGCCGCAGGCGCAGGGCGGGCTCTACAACGACGCCTCGCCGACCAATGTCGA
GGACGCCTACAACGCGCTGAAGACCTACCTGATGCTGTCGGACAAGCGCCACGTCGAGCAGGCGCACCTG
ACCGACCAGATCGCGCGCTTCTGGCGCGGCTGGCTGGAAACCAATCGCGGGAACATGCCGCGCGACGAGA
TGATCCGCAGCGCCGAGCGCATGATCACCTTCTACCTGTCGCGCGTGCAGGACAACGACTGGCCGATGAT
CGACGCCAACCTGGCCCTGGTCGACCAGACCCGCGAGAACCTGCGCCACGTGGTGCGCGGCATGCCGGCC
CGCCAGCGCGTCTACGAGGAGATCAAGGCGCGCGCCTCGACGCGTTATGCCCCGATGACGATCGCGCGCA
TCGTCGGCGAGGACAACACCGGCCTGGTGGCCGGCAGCTACGCGATTCCCGGCACCTTCACGCGCGACGC
CTGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCCACCAAGGAACTGCAGGCCAAGGACTGGGTG
CTCAACACCGCCTCGCAGGACGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAAGGTGCTGGTCG
GCATGTACAAGACCGAATACGCCCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTGCAGAACTTCGG
CAGCTTCGGCCAGGCCGTGGACGCCATGAACAAGCTCGGCGACCCGCAGGACTCGCCGATCCGCAAGGTG
CTCGAGACCGCCTACGACCAGACCTCCTGGGATAACCCGTCGCTGGCCAACGTGTCGATCAAGAAGGCGC
AGACCGGCGTGGTGAACTGGGTCAAGCAGTGGTTCTCGCGCAAGCCGGGCGGGCAGCTGGCGGCCAACAT
CGACATCAACGGCAACCCGGTCGAGGTGCCGATGGGCCCGATCGGCCAGGAGTTCATCGGCCTGGGCCGG
ATCGTGCAGACCCACGACGGCGGCCAGTCGATGCTCAAGGGCTACATGGACACGCTCTCCAAGGTGCGCA
CCCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCT
CGACGGCAACGGCTCGGAACTGGCCGATTCGCTGAAGTACGTCGACGAGCAGATGCTGACCGGCCTGACC
GACTCGCAACGCAAGTCGCTGCGCCCGCTGCTGGTGCGCCCGCTGCAGCAGGCCTTCTCGGTGGTGATCC
AGCCGGCCTCGGTGGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTCCAGGCCTCGCTGGC
GAACAAGTACCCGTTCTCCGCCGGCGCCAAGGTGGAGGCCGCCTCGAGCGAGATCGCCCAGGTGTTCGGC
CCCGACGGCTCGATCTCGAAGTTCGTCGGCACCACGCTCGGGCCGCTCGCGGTGCGCCGCGGCGACACGC
TGACGGCACGCACCTGGGGCGACATGGGTCTGGCGCTGACGCCGGAATTCACCAGCGGCTTCGCGACCTG
GGTCGCGCCGCTGGCGGGGGGCGCGGCCACCAGCGCGGCCTCCTCCGAGCCGCAGACGGTGTTCCAGATC
CTGCCGCAGCCGAGCAGCGGGACCACCGAGTACACCATCGCGATCGACGGCCAGCAGCTGCGCTACCGCA
ACACGCCGCCGCAGTGGACCAACTTCGTCTGGCCGAACCCGAGCGGTTCGCCGGGTGCGACGCTGACGGC
CACCACCTTCGACGGCCGCACGCTGACCCTGGTCAACGAGCCGGGCCGCTACGGGCTGGAGAAGCTGATC
AACTCGGCGCAGCGCTCGCGCCGCCCGGACGGCACCTTCGACCTGGCCTGGACGCAGGGCAACGTCAACG
TGGCGGTGACGATGCGCATCATCAGCACCTCGCAGCCCTCGGGCGGCGGCAGCGGTGGCGGCGACGCGCC
GCAGCAGCAGAGCCTGCGCGGCCTGCATCTGCCCTCGTCGGTGGCGAACACCAGCGCGAGCGGCGCCGTC
AACGCGACGGCCCAGGCACCTGCCGGCACGTCCGGCGTCGCAACGGCCGCCAACGGCGCGGCCGCCAACG
CATCGAACGCACAGGGGGCGCAATGA
 Primer design