SecReT6
Protein ID: 330819529
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g04030
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]508453..512049 [+]
Producthypothetical protein
NoteTssM
UniProt IDF2LJL2
KEGG IDbgd:bgla_2g04030
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-90, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 2.40E-64, Aligned region: 458..488
IcmF-related [PF06761], Evalue: 2.40E-64, Aligned region: 503..803
IcmF-related [PF06761], Evalue: 2.40E-64, Aligned region: 1053..1064
DUF1215 [PF06744], Evalue: 6.20E-23, Aligned region: 939..1056
AAA_16 [PF13191], Evalue: 2.50E-05, Aligned region: 97..192
AAA_16 [PF13191], Evalue: 2.50E-05, Aligned region: 315..356
AAA_16 [PF13191], Evalue: 2.50E-05, Aligned region: 915..962
AAA_33 [PF13671], Evalue: 0.00077, Aligned region: 128..264
AAA_25 [PF13481], Evalue: 0.0094, Aligned region: 126..144
AAA_25 [PF13481], Evalue: 0.0094, Aligned region: 177..212
AAA_25 [PF13481], Evalue: 0.0094, Aligned region: 1003..1049
AAA_25 [PF13481], Evalue: 0.0094, Aligned region: 1103..1130
Protein Sequence: 1198 a.a.     [Download]
>gi|330819529|ref|YP_004348391.1| hypothetical protein bgla_2g04030 [Burkholderia gladioli BSR3]
MNLLKTWVRSRWFASAVGLALIAVLIWLGGPYLGLGDRQPLASPAARLALILALVLAWLVVLLVLQWRAQ
RKTARLSGELAGQEAKLAAEEPGSAERAALQQRFREAIDTLRRTRRNGRNLYALPWYVVIGPPGSGKSTL
LQNSGLDFPLSERFGNNALRGIGGTRDCDWWFTDEAVFLDTAGRYTTQDSDAAADASAWQAFLTLLRRYR
RRRPLNGVIVTMSVSDLLSFDETARQQHMRAVRRRLDELTQYLKVPVPVYLVFTKSDLVAGFGEFFDDLG
PELRAQVWGMTFPLEASLDGTACSRFAGEYDLLLERLNTRLIERLHAERDRGRRAAVLSFPQQLGAFREI
ARQFVEGTFGRNEYGTPPLLRGAYLSSGTQEGAPIDRMLGAVARTFGVDAARVQPGTSQRRTFFVERLLK
EVLFRESGLAGTNPRLERQKLLVQIAAYAGITLFTVLMVAGFATSYARNRAYVAEVQDSLKDLPGADTLA
GQPDLRSYFARALARLEVISDTQDSAGRYRDHVPLLMRFGLFQGRALYAQAHGAYLRELDGTLLPGVGLR
FREGLTDSANDPQTLYGYLKGYLMLGEPQHLVPDELAALARQEWQRLFPDDPAIRKALDKHFTARVEDPQ
RPRALSLDSGLVDQARATLKTADLATLIYGSVKLDADRSGVSPVRLDESLGLLGNVFRRKSGTPLAQPLP
VLFTRPYFAYEVNGGLDRSVDGFVKDYWVFDTGRVDPLARSRYAQQVLTLYEQDYIRNWDGLLGDLQLQP
VVSIQDASALAAKLSGPSSPLKALLNLVRDNTSDLLRSGPAGANGASGVAGVSGTEVGDQAKTIGENIAA
RRALNTRLAGELRTAGAPLPYGVTLASRNHGGGQDAGSQPGAAIEAHFAQIDQLSLGSPGATPLDHTIGV
LDQLGKTLLTMNDLSDPSAQNNPALLSARQEAQQLPPQVAGLISGLTGKSADLVASGGSAALADQFRAAA
GNDCASFVDGRYPFASGGATDIPLQNFTELFGGGGRFDAFFKSALAARVDTGGSAWRWKPNMPPAPSGVL
AGAQLADEIRQLYFGGGAQVHVGFTLLAPQFDTAIARVVVEVDGQKYDFTANAASVASSSMSWPGPQPGH
VVISAFDGSNHPVGTPYRFDGDWSLFHALDAGRLQKEGELRFTASYDFAGHPVKLTIQPASLRNPFLNDA
VRRFRCPR
 
Nucleotide Sequence: 3597 bp     [Download]
>gi|330819133|ref|NC_015376.1|:508453-512049 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGAACCTGCTGAAAACCTGGGTGCGGTCCCGGTGGTTCGCCTCGGCGGTCGGCCTCGCGCTGATCGCCG
TGCTGATCTGGCTCGGCGGCCCCTATCTCGGCCTCGGCGATCGCCAGCCGCTGGCCAGCCCCGCCGCGCG
CCTGGCGCTGATCCTCGCGCTGGTGCTGGCCTGGCTGGTGGTGCTGCTGGTGCTGCAATGGCGCGCCCAG
CGCAAGACCGCGCGCCTGTCCGGCGAGCTGGCCGGGCAGGAGGCCAAGCTGGCCGCCGAGGAGCCGGGCA
GCGCCGAGCGCGCCGCCTTGCAGCAGCGCTTTCGCGAGGCCATCGACACGCTGCGCCGCACGCGCCGCAA
CGGCCGCAATCTCTACGCGCTGCCGTGGTACGTGGTGATCGGGCCGCCGGGCTCGGGCAAGAGCACCCTG
CTGCAGAATTCCGGGCTCGATTTCCCGCTGTCCGAGCGCTTCGGCAACAATGCGCTGCGCGGCATCGGCG
GCACGCGCGACTGCGACTGGTGGTTCACCGACGAGGCCGTGTTCCTCGACACCGCCGGGCGCTACACCAC
GCAGGATTCCGACGCGGCCGCCGACGCCTCGGCCTGGCAGGCCTTCCTGACCCTGCTGCGCCGCTATCGC
CGCCGCCGGCCGCTGAACGGCGTGATCGTGACGATGAGCGTGTCGGACCTGCTGAGCTTCGACGAAACCG
CGCGCCAGCAGCACATGCGCGCGGTGCGCCGGCGCCTGGACGAACTCACGCAATACCTGAAGGTGCCGGT
GCCGGTCTACCTGGTGTTCACCAAGAGCGACCTGGTGGCGGGCTTCGGCGAGTTCTTCGACGACCTCGGC
CCCGAGCTGCGCGCCCAGGTCTGGGGCATGACCTTCCCGCTCGAGGCCAGCCTCGACGGCACCGCCTGCA
GCCGCTTCGCGGGCGAATACGACCTGCTGCTGGAGCGCCTCAACACGCGCCTGATCGAGCGCCTGCACGC
CGAGCGCGACCGCGGCCGGCGCGCCGCCGTGCTGAGCTTCCCGCAGCAGCTCGGCGCGTTCCGCGAGATC
GCGCGGCAGTTCGTGGAAGGCACCTTCGGGCGCAACGAATACGGCACGCCGCCGCTGTTGCGCGGCGCCT
ACCTCAGCTCGGGCACGCAGGAAGGCGCGCCGATCGATCGCATGCTCGGCGCGGTGGCGCGCACCTTCGG
CGTCGATGCCGCGCGCGTGCAGCCCGGCACCAGCCAGCGCCGCACCTTCTTCGTCGAGCGCCTGCTCAAG
GAGGTGCTGTTCCGCGAATCGGGCCTGGCCGGCACCAACCCGCGCCTGGAGCGCCAGAAGCTGCTGGTCC
AGATCGCCGCCTATGCCGGCATCACCCTGTTCACGGTGCTGATGGTGGCCGGCTTCGCCACCAGCTACGC
GCGCAACCGCGCCTACGTGGCCGAGGTGCAGGACAGCCTGAAGGACCTGCCCGGCGCCGACACGCTGGCC
GGGCAGCCCGACCTGCGCAGCTATTTCGCGCGCGCGCTGGCGCGGCTGGAGGTGATCTCGGACACGCAGG
ATTCGGCGGGCCGCTATCGCGATCATGTGCCGCTGCTGATGCGCTTCGGGCTGTTCCAGGGCCGAGCGCT
CTATGCGCAGGCGCACGGTGCCTACCTGCGCGAGCTCGACGGCACCCTGCTTCCCGGCGTCGGCCTGCGT
TTCCGCGAGGGGCTGACCGACAGCGCCAACGATCCGCAGACGCTGTACGGCTACCTGAAGGGCTACCTGA
TGCTCGGCGAGCCGCAGCACCTGGTGCCCGACGAGCTGGCCGCGCTGGCGCGCCAGGAATGGCAGCGCCT
GTTCCCCGACGATCCGGCGATCCGCAAGGCGCTCGACAAGCACTTCACGGCGCGCGTCGAGGATCCGCAG
AGACCGCGCGCGCTGTCGCTCGACAGCGGCCTGGTGGACCAGGCCCGCGCCACGCTGAAGACGGCCGACC
TCGCCACGCTGATCTACGGCAGCGTCAAGCTCGACGCCGATCGCTCCGGCGTCTCGCCGGTGCGGCTCGA
CGAATCGCTGGGCCTGCTCGGCAACGTGTTCCGTCGCAAGAGCGGCACGCCGCTCGCGCAGCCGCTACCG
GTGCTGTTCACGCGGCCGTATTTCGCCTACGAGGTGAACGGCGGGCTCGATCGCTCGGTGGACGGCTTCG
TCAAGGACTACTGGGTGTTCGACACGGGCCGCGTCGATCCGCTGGCGCGCTCGCGTTACGCGCAGCAGGT
GCTCACGCTCTACGAGCAGGACTACATCCGCAACTGGGACGGCCTGCTCGGCGATCTGCAGCTGCAGCCG
GTGGTCAGCATCCAGGACGCCAGCGCGCTGGCCGCGAAGCTGTCGGGGCCGAGCTCGCCGCTCAAGGCGC
TGCTGAACCTGGTGCGCGACAACACCAGCGACCTGCTGCGCAGCGGCCCGGCCGGCGCCAACGGCGCAAG
CGGCGTGGCGGGCGTATCGGGCACCGAGGTGGGCGACCAGGCCAAGACCATCGGCGAGAACATCGCCGCG
CGCCGCGCGCTGAACACCAGGCTGGCCGGCGAGCTGCGCACGGCCGGCGCGCCGCTGCCCTATGGCGTGA
CGCTGGCCTCGCGCAACCACGGCGGCGGCCAGGACGCCGGCAGCCAGCCGGGCGCGGCGATCGAGGCGCA
TTTCGCGCAGATCGACCAGCTGAGCCTGGGTTCGCCCGGCGCCACGCCGCTCGATCACACGATCGGCGTG
CTCGACCAGCTCGGCAAGACCCTGCTGACCATGAACGACCTCAGCGACCCGAGCGCGCAGAACAACCCGG
CCCTGCTGTCGGCGCGCCAGGAAGCGCAGCAACTGCCGCCGCAGGTGGCGGGGCTGATCTCGGGCCTGAC
CGGCAAGAGCGCCGACCTGGTGGCCAGCGGCGGCAGCGCCGCGCTGGCCGACCAGTTCCGCGCGGCGGCC
GGCAACGACTGCGCGAGCTTCGTCGACGGCCGCTACCCGTTCGCCTCGGGCGGCGCCACCGATATCCCGC
TGCAGAACTTCACCGAGCTGTTCGGCGGCGGCGGGCGCTTCGACGCCTTCTTCAAGTCGGCGCTGGCCGC
GCGCGTCGACACCGGCGGCAGCGCCTGGCGCTGGAAGCCGAACATGCCGCCGGCCCCGAGCGGCGTGCTG
GCCGGCGCGCAACTGGCCGACGAGATCCGCCAGCTCTACTTCGGCGGCGGCGCCCAGGTGCATGTGGGCT
TCACCCTGCTCGCGCCGCAGTTCGACACCGCGATCGCGCGCGTGGTGGTGGAGGTGGACGGCCAGAAGTA
CGACTTCACGGCCAATGCCGCCAGCGTGGCCTCCAGCTCAATGAGCTGGCCCGGCCCGCAGCCCGGCCAT
GTGGTGATCAGCGCCTTCGACGGCTCGAACCACCCGGTCGGCACGCCCTACAGGTTCGACGGCGACTGGT
CGCTGTTCCATGCGCTCGACGCGGGGCGCCTGCAGAAGGAGGGCGAGCTGCGCTTCACGGCCAGCTACGA
TTTCGCCGGCCATCCCGTGAAGCTGACGATCCAGCCCGCCAGCCTGCGCAACCCCTTCCTCAATGACGCG
GTGCGTCGCTTCAGGTGCCCGCGATGA
 Primer design