SecReT6
Protein ID: 332161224
SecReT6 ID427
T6SS typei3
Gene symbol-
Locus tagYE105_C1602
StrainYersinia enterocolitica subsp. palearctica 105.5R(r)
Repliconchromosome [GenBank: NC_015224] [Browse all T6SS(s) in this replicon]
Location [Strand]1878053..1881886 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KS43
KEGG IDyep:YE105_C1602
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-84, Aligned region: 583..898
ImcF-related_N [PF14331], Evalue: 7.70E-71, Aligned region: 251..535
DUF1215 [PF06744], Evalue: 7.60E-29, Aligned region: 627..641
DUF1215 [PF06744], Evalue: 7.60E-29, Aligned region: 710..732
DUF1215 [PF06744], Evalue: 7.60E-29, Aligned region: 1014..1127
Protein Sequence: 1277 a.a.     [Download]
>gi|332161224|ref|YP_004297801.1| hypothetical protein YE105_C1602 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
MSYLNRLFSGWAMKRILLVGCFLLLAAAIWFLGPFLGFGETRPLEGYEPRIIFLLLALALLLGFWFNVPR
FVLLAVVACAAVWVIAPFILVGDSHPLEDPLRRGAIIAFIAFITILYGVWRFMRALALNPALLDNFINPK
KDQSELEPDLSEINAVIRNGINYVRRIHSGIPTWKRFFVSSRWRSELPWFMVLGTKSAGKTSLILSSGQD
FPLPEQLDRIGKENVPTQHCECLFSNDALFLDTAGKYIDDGKEHQIEWNGILKALKKYRPVKAVNGVIVA
ISVTDILGKSKAELLTLSATLRARLDDVRGALGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVT
FPYNEDKGRADMELEQRISTELALLENRISNNMHVRQQEEYSVTDRKGMYALPQDFRLLSQRVTEVLQNV
FFASRFDETKFHTTLRGIYFISSCQPANIGLLNNSTLVQKWRNVIRHMKPASPASLSQRSDDEGQLISET
AYGKQYFLKQLFRDVITQDGDLVSYNLKVQSKYRFQNLLGHVACIGLAVWLVWAFLISFQHNDGYLQAIG
TKLQHLESSVSRYVKTTNEQMLPTLLNATQQLPEYGTLDVENPSLDWRYGLYTGGAVSRGANNLYQFFLQ
KHLFPMVEREAEVSLKNAINSGDSEAVYVALKLYLMLTDEEHFDQSYVVDKVTQAWQKSGKIEPYEEKGI
FASHLNTLFTQKAWRQYGQAADSELIKQARAMLAEKTETARLWGRVQSHLQAQAPANLTLRKMVGENATQ
VFTLSDAELLHEGVPGLYTHAGYHQVVKKKLTPLLMQLQQEDRWVMAQPLTSSFDPLALQQDVLTLYLKE
YTDYWKRFLSSVRLISVDADSGEYAEGLSLDIALLRTLVSENSPLLNLAKQSVKETTLVETVKEKTLLDD
ITIRNQGNLVNQAKKVQEKIAFRENKLVQEFVDSQFDGLRAFVKGEPSDGENNSNLSVIQGTQMSRVIGA
LNDQYTRLVVFNSAFEYGDIPPISHGGERIAIESQTWPDPFSNIIAPLLTSSSQKFENKVITHTSKAIDM
GIGEICRNTIQGRYPFADSEKVVSLSDFERFFGAGGTVDSYFKKNLESKVDTTTTPWRYKGSASRDGLEF
FEQAAVIRNALFNASEGRKVALDFSVSVRYLAPSITQLIMNFDGNIVRYSHGPVTPSFFKWPGVRQGTIV
SLTAQRQQASAMPDILLRGPWALLKWADKADEVAQDASGMQLLTYVMGKDRVELEVSGLTYGNESISELL
RGFQCPSALNDDMHEIW
 
Nucleotide Sequence: 3834 bp     [Download]
>ref|NC_015224.1|:1878053-1881886 hypothetical protein YE105_C1602 [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGAATATTGCTGGTGGGCTGCTTTCTAT
TACTGGCTGCCGCAATATGGTTTTTGGGGCCTTTCCTCGGATTTGGCGAGACGCGGCCGCTTGAAGGTTA
CGAACCCAGAATTATTTTCTTACTGCTGGCTCTGGCTCTGTTATTGGGCTTTTGGTTTAACGTGCCGCGC
TTTGTTCTGTTGGCGGTGGTCGCCTGCGCTGCGGTATGGGTTATCGCGCCCTTTATATTAGTAGGGGATA
GCCATCCGCTGGAAGATCCATTGCGTCGTGGCGCAATCATCGCTTTTATTGCCTTTATCACCATTCTTTA
TGGTGTGTGGCGTTTTATGCGGGCTTTAGCGCTCAACCCTGCGCTATTGGATAATTTTATCAACCCGAAG
AAAGATCAATCTGAACTTGAACCTGACCTTTCTGAAATCAATGCGGTGATTCGCAATGGCATAAATTATG
TCCGTCGTATTCACAGTGGCATTCCAACCTGGAAGCGTTTTTTTGTTTCCAGCCGCTGGCGTAGCGAACT
GCCTTGGTTCATGGTGCTGGGCACCAAGAGTGCGGGTAAAACCTCACTGATCCTCTCATCAGGACAAGAT
TTCCCTCTGCCTGAGCAGTTGGATCGCATCGGTAAAGAAAATGTACCGACTCAGCATTGCGAATGTCTGT
TCTCTAATGATGCCCTGTTTTTAGATACCGCCGGTAAGTACATTGATGACGGCAAAGAGCATCAAATTGA
ATGGAATGGCATCTTAAAGGCGCTGAAAAAGTATCGTCCGGTCAAGGCGGTTAACGGCGTTATTGTGGCT
ATTTCAGTCACCGATATTTTGGGTAAAAGTAAAGCCGAGTTATTGACGCTATCGGCCACGCTGCGCGCGC
GTTTAGATGATGTTCGTGGTGCGCTCGGTGTTCGTTTCCCGGTATATGTGACTATCACCAAACTGGATCA
ACTGTCTGGTTTTGATGAGTATTTCCGCAATTTAACCGCCGAAGACCGCGAACAAATCTGGGGTGTGACT
TTCCCTTATAACGAGGACAAAGGGCGCGCGGATATGGAGCTTGAGCAGCGTATCAGCACTGAGTTGGCAC
TGCTTGAAAACCGCATCAGCAACAACATGCATGTGCGTCAGCAAGAAGAGTATTCCGTCACTGATCGTAA
AGGCATGTATGCGTTACCGCAGGATTTCAGATTGTTGTCCCAACGGGTGACTGAAGTCTTGCAGAATGTG
TTTTTTGCCTCGCGTTTTGATGAGACAAAGTTCCATACCACGTTGCGTGGGATCTATTTTATCAGCAGTT
GCCAGCCTGCGAATATTGGGCTGTTAAATAACAGCACCCTGGTCCAGAAATGGCGCAATGTTATTCGTCA
TATGAAGCCTGCATCTCCGGCCTCGCTTTCGCAAAGAAGTGATGATGAAGGTCAACTGATCAGCGAAACG
GCTTATGGAAAACAATATTTCCTCAAGCAGCTATTCCGTGACGTCATCACCCAAGATGGGGATTTGGTGA
GCTATAACCTCAAAGTGCAATCCAAATACCGTTTCCAGAATTTATTGGGACACGTGGCTTGTATCGGGCT
GGCGGTGTGGCTGGTATGGGCATTCCTTATCAGTTTCCAGCACAACGATGGCTATTTACAGGCGATTGGT
ACCAAGCTCCAGCACTTAGAGAGCAGCGTTAGCCGTTATGTTAAAACCACCAATGAGCAGATGTTACCCA
CGCTGTTGAATGCCACTCAGCAGTTACCTGAGTACGGCACGCTGGATGTGGAAAACCCGAGTCTTGATTG
GCGTTATGGTTTATACACTGGCGGGGCGGTGTCTCGCGGCGCGAACAATTTGTATCAGTTTTTCCTGCAA
AAACACCTCTTCCCGATGGTTGAACGTGAGGCCGAAGTCTCATTAAAAAATGCGATCAATAGTGGTGATT
CTGAAGCGGTCTATGTCGCGTTAAAACTCTATCTCATGCTGACTGATGAAGAACATTTCGATCAGAGTTA
TGTGGTCGATAAAGTCACTCAAGCTTGGCAGAAGAGCGGGAAAATCGAGCCTTATGAGGAGAAAGGTATT
TTCGCCTCCCATTTGAATACGCTTTTCACCCAAAAAGCGTGGCGACAATATGGACAAGCGGCAGATAGCG
AGCTTATCAAACAGGCCAGGGCCATGCTGGCAGAGAAAACTGAGACTGCCAGACTGTGGGGGCGCGTTCA
ATCACATTTACAGGCACAAGCGCCCGCCAATCTGACATTACGTAAAATGGTGGGTGAGAATGCGACACAG
GTTTTTACCCTATCGGATGCCGAATTACTGCATGAAGGGGTTCCGGGGTTATATACCCACGCCGGGTATC
ATCAGGTGGTTAAAAAAAAGCTTACGCCATTGCTGATGCAACTTCAGCAAGAGGATCGTTGGGTGATGGC
TCAGCCATTGACTTCTTCATTTGATCCTCTGGCGCTACAGCAAGATGTGCTAACCCTGTACTTGAAAGAA
TACACCGATTACTGGAAACGCTTCCTCTCCAGTGTGCGCCTGATTTCTGTTGATGCTGACAGTGGAGAGT
ATGCAGAAGGGTTATCTCTGGATATTGCGCTGTTGAGAACGCTGGTGTCAGAGAACTCACCTTTGCTCAA
TTTGGCAAAGCAGTCAGTGAAAGAAACGACGTTAGTTGAAACCGTAAAAGAGAAAACACTACTCGACGAT
ATAACAATAAGAAATCAGGGAAATTTAGTTAACCAGGCTAAAAAAGTGCAGGAAAAGATAGCTTTTCGTG
AGAATAAGCTGGTTCAGGAATTTGTTGATAGCCAATTTGACGGACTGCGCGCTTTTGTTAAGGGCGAACC
GAGCGATGGGGAGAATAACAGTAACCTTTCTGTGATTCAGGGCACCCAGATGAGCCGGGTTATTGGTGCG
TTGAACGACCAATATACCCGTTTGGTGGTGTTTAACAGCGCGTTTGAATATGGCGATATCCCTCCGATCT
CTCACGGTGGGGAGCGTATCGCGATTGAGTCACAAACCTGGCCGGATCCGTTTAGCAATATCATTGCGCC
ACTTTTAACCAGTTCATCGCAGAAGTTTGAAAATAAAGTGATTACCCACACGTCGAAGGCCATCGATATG
GGGATCGGTGAGATATGCCGCAATACCATACAGGGGCGTTATCCCTTTGCTGATAGTGAGAAAGTCGTCA
GTTTGAGTGATTTTGAGCGCTTCTTCGGCGCGGGTGGCACGGTGGACAGTTACTTTAAGAAGAACCTGGA
AAGCAAAGTCGACACTACCACCACGCCTTGGCGTTATAAAGGCAGCGCAAGCCGTGATGGTCTGGAATTT
TTTGAACAGGCGGCGGTGATTCGCAATGCATTATTTAATGCCAGTGAAGGCCGCAAAGTGGCTTTAGACT
TCTCGGTATCCGTGCGTTATTTAGCCCCCTCAATTACGCAATTAATCATGAATTTTGACGGGAATATTGT
GCGCTATTCCCACGGCCCGGTGACGCCATCATTCTTCAAATGGCCGGGAGTTCGTCAAGGAACAATAGTG
AGTTTAACTGCTCAGCGCCAACAAGCTTCCGCGATGCCAGACATCCTGCTGCGTGGCCCTTGGGCATTGC
TGAAATGGGCTGATAAGGCTGATGAAGTGGCACAAGACGCCAGTGGCATGCAACTTCTGACCTATGTCAT
GGGCAAAGATCGCGTCGAGCTGGAAGTGTCCGGTTTGACTTACGGTAATGAGAGTATCAGTGAACTGCTT
AGAGGTTTCCAATGCCCAAGTGCGCTCAATGATGATATGCATGAAATTTGGTGA
 Primer design