SecReT6
Protein ID: 332283608
SecReT6 ID436
T6SS typei3
Gene symbol-
Locus tagPT7_0355
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]414643..418257 [+]
Producthypothetical protein
NoteTssM
UniProt IDF4GWM2
KEGG IDput:PT7_0355
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-95, Aligned region: 204..475
ImcF-related_N [PF14331], Evalue: 1.30E-95, Aligned region: 948..983
ImcF-related_N [PF14331], Evalue: 1.30E-95, Aligned region: 1058..1072
IcmF-related [PF06761], Evalue: 2.10E-87, Aligned region: 522..832
DUF1215 [PF06744], Evalue: 1.20E-32, Aligned region: 941..1065
Protein Sequence: 1204 a.a.     [Download]
>gi|332283608|ref|YP_004415519.1| hypothetical protein PT7_0355 [Pusillimonas sp. T7-7]
MSSLLSFLLSRGLWSFFGLLALALLIWIAGPLLAFGAVRPLESSTVRIAVIVAMFALWLLRLLWRKWREG
RLNAQLLGQLRRPAKKAAPEEPEQNPEIKELSDRFDEAIDLLRKMRFDGKASRFNLARFSRQHLYQLPWY
VFIGAPGSGKTTALVNSGLNFPLADRFGKVALRGVGGTRNCDWWFTDDAVLLDTAGRYTTQESDSTGDEE
EWRGFLDLLIRYRGRQPVNGVMLTVSIEDLLSSSDTERVQHAAVLRRRLQELREQLGIQFPVYVLVTKSD
LMSGFNEYFASCNREALKQVWGFTFPHATLQADGFNLHESFNAEYDLLKQRLYAGLSDVINAEPDESRRA
LAYLLPQQFAGLQPILGHFLSDVFATSKFESSLLPRGVYFTSGTQGGRTFDHVTGQLKRYLKIDGLSSVS
SVEGGSANGHGRSYFLQNLLQKVIFPESGLAGRNMRWERRYRRLQWGGYAAVSACLVLLLIGWVNSYRNN
SRYLEAVQARIPEVESLGRQIKLDASGDVLGLLPYLDALQALPAGDGFETDDPPFSYGFGLYQGYKVQAG
ADGAYQVAQDQVLVPQVAQRVTAALGSAPPDDLEYSYEALRAYLMLYDAQRYNPNFMHTWLLSDMRALLA
EGHTRRQYEQLSGHLRSLVDSRVLTSPFAKDEALIEQTRANLDQHALSERAYSRLKRLLLNERVPDTTFL
DLGGPSSMSVFARSSGKPLNEGIPGLYSYKGYWDKVDKQVDDVAANLKRDDLWVLGVDATKGERAIPNEQ
LITDIRRLYLADYVKNWDMYLADLTLKPAQTLLQSIEMARTLSSGNSPLVQLIQSVARETTLLRDSESDE
RSLVDRAKDRVNSTQSSLERMFGSVVPGDPTRGANSGERIEALVDRHFSAYRNLASAPQGGQAPIAATTD
LINDLYVYLTASDAALRSASPLPTSSVVTQLQAEAGRLPKPVNGMLTQLSLHASNEVSDVERQQLGRTIS
ANLGVFCRQAIAGRYPFSPKSKRDVAPNDFARLFAPGAMMDDFFQKKLVNHVDMSGSRWRFKPGMDGEQG
EMAGYLDAFQRASTIRSVYFTATGTEPSYRVSIRPMHMDADITQFIMNVDGQAVSYAHGPQVGTTVQWPG
TRGSNQVSIELLPQSGVSGLSASGPWALNRLLDKASLKRGPSPEITIATFSIGGRQVVLELSANTVKSPF
RLSEMQGFSCPGKG
 
Nucleotide Sequence: 3615 bp     [Download]
>gi|332283253|ref|NC_015458.1|:414643-418257 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAGCAGTCTGTTGAGTTTTCTGCTTAGTCGCGGCCTCTGGAGCTTTTTTGGTCTGCTGGCCCTGGCGC
TGCTGATATGGATTGCCGGCCCGCTGCTGGCCTTCGGCGCAGTCCGGCCTCTGGAGTCCTCAACGGTCCG
TATCGCCGTCATTGTGGCCATGTTTGCTCTGTGGTTGTTGCGTTTGTTGTGGCGCAAATGGCGTGAAGGA
CGTTTGAATGCACAACTGCTGGGACAGCTGCGCCGACCGGCCAAGAAGGCCGCGCCCGAAGAGCCCGAGC
AGAATCCTGAAATCAAGGAGCTTTCCGACCGGTTCGACGAGGCTATAGACCTGTTGCGCAAGATGCGCTT
TGACGGCAAGGCCAGCCGTTTCAACCTGGCTCGGTTTTCGCGGCAGCACTTGTATCAGTTGCCTTGGTAT
GTATTCATCGGCGCTCCTGGTTCAGGCAAGACCACGGCACTGGTCAATTCGGGCCTGAATTTTCCGCTGG
CGGATCGCTTCGGCAAGGTGGCGTTGCGGGGTGTTGGCGGCACCCGCAATTGTGATTGGTGGTTTACCGA
CGACGCTGTTCTGCTGGATACGGCTGGCCGCTATACCACACAGGAAAGTGATTCGACCGGCGACGAAGAG
GAATGGAGGGGTTTCCTGGACCTGCTGATCCGCTATCGCGGACGGCAGCCTGTCAATGGCGTGATGCTGA
CGGTAAGCATAGAAGACTTGCTGTCGTCGTCCGACACCGAGCGCGTACAGCATGCGGCCGTGTTGCGCCG
GCGCCTGCAGGAGCTGCGTGAGCAACTGGGTATTCAGTTTCCGGTGTATGTGCTGGTGACCAAGTCGGAC
CTGATGTCGGGCTTCAACGAGTACTTTGCTTCGTGCAATCGTGAAGCGCTCAAGCAGGTATGGGGGTTCA
CTTTTCCTCATGCCACACTGCAGGCCGACGGATTCAATTTGCATGAGTCCTTCAATGCCGAATACGACTT
GCTGAAGCAGCGTCTGTATGCGGGCTTGTCCGATGTGATCAACGCTGAGCCGGATGAGTCCAGGCGTGCG
CTGGCTTACTTGCTGCCACAGCAGTTTGCGGGCCTGCAGCCCATACTGGGCCATTTCCTGAGCGATGTGT
TCGCTACGTCCAAGTTCGAGTCGTCTTTGTTGCCGCGAGGCGTGTATTTCACCAGCGGTACGCAGGGCGG
GCGGACTTTCGATCATGTCACCGGCCAGCTCAAGCGATATCTGAAGATTGATGGCTTGTCCAGCGTGAGC
AGCGTGGAGGGCGGGTCGGCCAATGGGCACGGGCGCAGCTATTTTTTGCAGAATCTTCTGCAGAAAGTGA
TATTTCCGGAGTCTGGGCTGGCCGGGCGCAATATGAGGTGGGAGCGCCGCTACCGGCGTTTGCAGTGGGG
CGGCTATGCGGCGGTCAGCGCCTGCCTGGTGCTGCTCCTGATAGGCTGGGTCAATAGCTACCGGAACAAT
AGCCGTTATCTTGAAGCGGTACAGGCGCGCATTCCCGAGGTCGAATCCCTGGGCCGACAAATCAAGCTGG
ATGCGTCCGGTGATGTACTGGGTCTGCTCCCGTACCTGGATGCCTTGCAGGCCCTGCCGGCTGGCGACGG
CTTTGAAACGGACGACCCGCCGTTCAGTTATGGTTTTGGGCTTTATCAGGGGTACAAAGTTCAGGCCGGC
GCGGATGGCGCCTATCAGGTCGCGCAAGACCAGGTGCTTGTTCCGCAGGTGGCGCAGCGTGTCACGGCGG
CACTGGGTTCGGCGCCCCCAGATGATCTGGAGTATTCATACGAGGCGCTGCGCGCCTACCTGATGCTCTA
TGACGCACAGCGCTACAACCCGAATTTCATGCATACTTGGCTTTTGTCCGATATGCGTGCCTTGCTTGCA
GAGGGACATACCAGAAGGCAATACGAACAGTTGTCGGGACACTTGCGCAGCCTGGTTGACAGCAGGGTGC
TCACCTCGCCTTTTGCCAAGGATGAGGCGCTGATCGAGCAGACGCGTGCCAATCTTGATCAACATGCCTT
GTCCGAGCGGGCCTATAGCCGCTTGAAGCGTTTATTGCTGAATGAGCGAGTACCGGACACGACTTTTCTG
GATCTGGGCGGGCCGTCGTCGATGTCCGTGTTTGCGCGCAGTAGCGGTAAACCATTGAATGAAGGCATTC
CTGGCCTTTATAGCTATAAAGGCTACTGGGACAAGGTGGACAAACAGGTGGATGACGTTGCCGCCAATCT
CAAGCGCGATGATCTTTGGGTATTGGGCGTGGACGCCACCAAAGGTGAGCGAGCCATACCCAATGAGCAA
CTGATCACCGATATTCGGCGCCTGTATCTGGCTGACTACGTCAAGAACTGGGACATGTATTTGGCGGACT
TGACCTTGAAGCCGGCCCAGACTCTGCTGCAGAGCATAGAAATGGCCCGTACGCTTTCCAGCGGCAATTC
GCCACTGGTTCAATTGATTCAATCGGTGGCCAGGGAAACAACCTTGCTGCGTGACAGCGAGTCCGACGAA
CGCTCGCTGGTGGATCGTGCCAAAGACAGGGTGAACTCGACGCAAAGCTCGCTGGAACGTATGTTTGGTT
CTGTCGTGCCGGGTGATCCGACGCGAGGTGCGAATTCAGGGGAGCGCATCGAGGCGTTGGTGGACAGGCA
TTTCAGTGCCTATCGCAATCTGGCTTCGGCGCCTCAGGGAGGGCAGGCGCCCATCGCCGCGACGACTGAC
CTGATCAATGATTTATACGTTTACCTGACGGCTTCGGACGCCGCTTTGCGCAGCGCCAGCCCCCTGCCTA
CCTCCAGCGTGGTGACACAGCTGCAGGCGGAAGCGGGCAGGCTGCCCAAGCCGGTGAACGGTATGTTGAC
GCAGTTGTCTTTGCATGCATCCAACGAGGTCTCTGATGTTGAGCGCCAGCAGTTGGGGCGCACCATCTCC
GCCAACCTGGGTGTTTTCTGCCGCCAGGCTATTGCCGGACGCTACCCTTTTTCGCCCAAGTCCAAACGCG
ATGTGGCGCCGAATGATTTTGCACGCCTGTTTGCTCCAGGCGCCATGATGGACGACTTCTTCCAGAAAAA
ACTGGTGAACCACGTTGATATGTCGGGTTCGCGCTGGCGCTTCAAGCCCGGCATGGATGGCGAGCAGGGC
GAGATGGCCGGCTACCTGGATGCCTTTCAGCGTGCCAGCACCATACGCAGCGTCTATTTCACGGCAACCG
GCACAGAGCCTTCCTATCGCGTTTCGATCCGGCCCATGCATATGGATGCGGATATCACGCAGTTCATTAT
GAATGTGGATGGGCAAGCTGTGAGTTATGCGCATGGCCCCCAGGTGGGTACGACAGTGCAATGGCCGGGG
ACCCGAGGAAGCAATCAGGTCAGCATTGAACTGTTGCCGCAGTCGGGTGTATCGGGCTTGTCCGCCTCGG
GGCCGTGGGCGCTGAATCGTTTGCTGGACAAGGCAAGCTTGAAGCGCGGGCCTTCGCCGGAAATAACCAT
CGCCACATTTTCGATAGGGGGCAGGCAGGTGGTGTTGGAGCTGAGCGCGAATACAGTGAAAAGCCCATTT
CGGCTAAGTGAGATGCAGGGCTTCAGCTGCCCTGGAAAAGGATAA
 Primer design