SecReT6
Protein ID: 332285579
SecReT6 ID437
T6SS typei1
Gene symbol-
Locus tagPT7_2326
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T6SS(s) in this replicon]
Location [Strand]2480322..2484266 [-]
Producthypothetical protein
NoteTssM
UniProt IDF4GSD5
KEGG IDput:PT7_2326
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.80E-32, Aligned region: 168..349
ImcF-related_N [PF14331], Evalue: 6.80E-32, Aligned region: 352..394
ImcF-related_N [PF14331], Evalue: 6.80E-32, Aligned region: 993..1013
ImcF-related_N [PF14331], Evalue: 6.80E-32, Aligned region: 1149..1171
SPOR [PF05036], Evalue: 2.70E-05, Aligned region: 408..421
SPOR [PF05036], Evalue: 2.70E-05, Aligned region: 1156..1174
SPOR [PF05036], Evalue: 2.70E-05, Aligned region: 1240..1313
Protein Sequence: 1314 a.a.     [Download]
>gi|332285579|ref|YP_004417490.1| hypothetical protein PT7_2326 [Pusillimonas sp. T7-7]
MAKKLLSVLAGIMILLILALACWLVGVLLGWQLWQSLVLFLGCIMAVLIMGWLRRRWHAWRLRRRLARPA
LNTSESTAQLDADWRAGLTALRQSRLSRFGSPLYVLPWFLTLGPEDQARSAMLRRTAGRDAVSAGGDETP
ALQWWLLPSMVMLDPAPSASADVLAPSASGWQRMLQRMMHTRRREPLNGLVLSFSSDWLDKSSDAQLSDT
GHMLRQRLDELVRIYNARVPVYIVLTHCESVNGFSAWASSFAGDASKQAMGYVSKGKLASIGEFIDDAFG
HIVARMSDLRVLQGRHQHPTPEAFGLPERMFALSGRLDKVLRPAFQATPYAETPLLRGLFLTAGRAGDDS
HQADWFSAGLFDDVLPGQRHAWQALERLRHWRRLLRHAAVAGWLLACVAIGAVLVYSAQTAREQLQLAGK
GAGTAGADFSGDLSSDLRALHSVRHAAHSLNDRPGWQKHWMPFQGYVNNAQSELEDAYANAFYREVISAN
LNPLLMKVLEEPQSGAPDQATIALAQNLVRRINLLQARLAGQNLRTLPLPGTEMQALAAAIQKGTLNPID
GLLLGDMYRDYLGWQENTAILTDEQRALQKALSSLGLSARPIQWIYTWSILQPNLQPMRLTDFWSIGKAD
GLPEVPAALTLDGKKAITAFMKELARATGNDKAWQEREAQYQKLFMEEGLEHWYTFSDAFVHAPNLIDDA
SSRRTVLASLMTSTGPYNRYMGQLAKLGQALPAQSRPEWLQQAMHLDKLTGLVQLPKADGKESPAAGGSS
LTTLQSLKVVQDFGGDVIKALPEGSAIKQGFSSLTSDQQALSLLQEHLKGVRATILSLQQGDGNAMDTAI
QIWSYGHDPKVKNVALIDAHTAMEQLRQSYGASKNPRTAVVWQLEEGAIDFTLDYAARSAACSLQSNWEV
NVLGTVKGLTDKQLANTLLFGPQGQVNVFLDGDASHFVSRDGTRYMARKALGDVVPLNGQFYAFAGLAQL
RTATQAGQQLEDQRNKDASVALKDQAQQLDQKISKLEEVKGNVTLSTEPSQTNAGAQLRPESITLSLQCA
SGPITLRNLNFANSQVFTWSMSSCADTTLSIDYPGFELQKQWSAAGGFIQFLNEYASGVRRYTPADFPGQ
ANAMKQAGIEWLDISYRQQGQESVLKAFAEADKLHAQAQEIQSRLDAMQQEAAGAPDTQSSSGAPALPER
IITTCMGSSDSLGPVLTSSTETHVPEEQTGPVAMPEPSVAPAGQGHSAKASGRYAVQVGVFAHPDKVHAA
LEKAQYTLQDDPITLHGKEYRNIRVTGYKTRQEAEDAARQIGKLLGLKPVVVQG
 
Nucleotide Sequence: 3945 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c2484266-2480322 Pusillimonas sp. T7-7 chromosome, complete genome
ATGGCAAAGAAATTACTGAGCGTGCTTGCGGGGATCATGATCCTGCTCATCCTGGCACTGGCATGCTGGC
TGGTAGGAGTGCTTCTGGGTTGGCAGCTATGGCAATCGCTGGTCTTGTTTCTGGGCTGCATTATGGCCGT
ATTGATCATGGGGTGGTTGCGACGGCGTTGGCATGCATGGCGCTTGCGCAGGCGGCTGGCCCGCCCGGCC
TTGAACACCAGTGAAAGTACCGCCCAACTTGACGCGGATTGGCGTGCGGGGTTGACGGCCTTGCGGCAAT
CACGCCTGTCGCGTTTTGGCTCGCCGCTGTATGTATTGCCTTGGTTTTTGACGCTTGGGCCTGAAGATCA
GGCACGTTCGGCCATGCTGCGCCGGACTGCCGGCCGCGATGCCGTATCGGCGGGCGGTGACGAGACCCCA
GCCTTGCAGTGGTGGCTATTGCCCAGCATGGTCATGCTGGACCCGGCGCCATCGGCCAGCGCCGACGTGC
TCGCCCCGTCGGCTTCCGGTTGGCAGCGCATGCTGCAACGGATGATGCATACGCGCCGTCGCGAACCTCT
GAACGGGTTGGTGCTGTCTTTCAGCAGCGACTGGCTGGACAAGTCCAGCGATGCGCAGCTGTCTGATACT
GGCCATATGCTGCGCCAGCGTCTGGATGAACTCGTGCGTATCTACAACGCCCGTGTGCCTGTTTATATCG
TATTGACCCATTGCGAGTCAGTTAACGGGTTTTCAGCGTGGGCCAGCTCTTTTGCGGGTGACGCCAGCAA
GCAGGCCATGGGCTATGTAAGCAAGGGCAAGCTCGCCAGCATCGGGGAATTCATCGACGATGCCTTTGGG
CATATCGTGGCGCGCATGAGCGATCTGCGGGTGTTGCAGGGCAGGCATCAGCATCCGACCCCCGAAGCCT
TCGGCCTTCCCGAGCGCATGTTTGCCCTGTCCGGTCGTCTCGACAAAGTATTGCGCCCCGCTTTTCAGGC
CACGCCGTATGCGGAAACGCCGCTGCTGCGCGGCCTGTTCCTGACTGCTGGCCGTGCAGGTGATGACAGT
CATCAGGCAGACTGGTTCAGCGCCGGCTTGTTTGACGACGTATTGCCTGGTCAGCGTCATGCCTGGCAAG
CTCTGGAGCGTTTGCGTCACTGGCGCCGACTGTTGCGCCATGCCGCCGTGGCCGGCTGGCTGCTGGCGTG
CGTGGCGATTGGCGCGGTTCTGGTTTATTCCGCTCAGACCGCCCGGGAACAATTGCAACTTGCAGGAAAG
GGCGCCGGCACGGCTGGCGCTGATTTCTCGGGTGACTTGTCGTCAGACTTGCGTGCCTTGCATTCCGTAC
GGCATGCAGCGCACTCTCTGAATGACCGCCCCGGCTGGCAAAAGCACTGGATGCCATTCCAGGGGTATGT
GAATAATGCCCAGAGCGAGCTTGAAGACGCTTATGCAAATGCTTTCTATCGCGAGGTGATCTCGGCCAAT
CTGAATCCCTTGCTCATGAAAGTACTGGAGGAACCGCAGTCAGGCGCGCCTGATCAGGCGACCATTGCAT
TGGCGCAGAATCTGGTTCGTCGCATCAACCTGCTGCAAGCCCGGCTGGCCGGTCAGAACTTGCGCACATT
ACCCTTGCCTGGCACGGAAATGCAGGCCTTGGCGGCAGCCATTCAGAAAGGAACGTTGAACCCCATTGAT
GGGCTGTTGCTGGGCGATATGTATCGCGATTACCTGGGTTGGCAGGAGAATACCGCCATTCTGACCGATG
AGCAGAGAGCCCTGCAAAAAGCCCTGAGTAGTCTGGGCCTGTCAGCACGTCCGATTCAGTGGATTTATAC
ATGGAGCATCTTGCAGCCTAATTTGCAGCCCATGCGCCTGACGGATTTTTGGAGTATTGGCAAAGCAGAC
GGTTTGCCTGAAGTGCCCGCGGCCTTGACGCTTGATGGAAAAAAAGCCATAACCGCCTTCATGAAAGAAC
TGGCGCGTGCCACAGGCAATGACAAAGCCTGGCAGGAGCGTGAGGCACAGTATCAGAAGTTGTTCATGGA
AGAGGGGCTGGAGCACTGGTACACCTTTTCCGATGCCTTTGTACATGCGCCCAATCTGATTGATGATGCC
AGCTCACGGCGCACCGTCCTGGCTTCGCTCATGACGAGCACCGGACCCTACAATCGGTACATGGGCCAAC
TGGCCAAGCTGGGGCAGGCCTTGCCAGCCCAATCACGGCCTGAATGGCTGCAGCAGGCCATGCATCTGGA
CAAGCTCACTGGGCTGGTGCAATTGCCCAAGGCCGATGGCAAAGAGTCGCCCGCAGCTGGCGGTTCCAGC
TTGACCACTCTGCAAAGCCTGAAAGTTGTGCAGGATTTTGGTGGCGATGTAATCAAAGCCCTTCCCGAAG
GCAGCGCCATCAAGCAAGGGTTCTCGAGTCTGACTTCCGATCAGCAGGCATTGTCACTATTGCAAGAACA
CCTGAAAGGCGTAAGAGCAACAATCCTGTCCTTGCAGCAGGGGGACGGCAATGCAATGGATACGGCCATA
CAGATTTGGTCCTATGGCCATGACCCGAAGGTAAAGAACGTGGCATTGATCGACGCCCACACGGCCATGG
AGCAGTTGCGGCAGTCATATGGCGCTTCAAAAAATCCTCGAACGGCTGTCGTTTGGCAATTGGAGGAAGG
GGCCATAGACTTCACGCTGGACTATGCCGCGCGTAGCGCAGCATGCAGCTTGCAGAGCAACTGGGAGGTG
AATGTGCTGGGTACTGTCAAGGGGCTGACAGACAAGCAGTTGGCCAATACATTGCTGTTCGGCCCGCAGG
GGCAGGTCAATGTCTTTCTGGATGGTGATGCCAGCCATTTTGTTTCTCGCGATGGTACGCGTTATATGGC
CAGAAAAGCCCTGGGCGATGTTGTGCCGCTCAATGGCCAGTTCTATGCATTTGCCGGTCTTGCACAGCTG
CGTACGGCCACGCAGGCCGGGCAACAGCTGGAGGACCAGCGCAACAAGGATGCCAGCGTCGCATTGAAGG
ATCAGGCCCAGCAACTGGATCAAAAAATATCCAAGCTGGAAGAGGTCAAGGGCAATGTGACCTTGAGTAC
GGAGCCGTCGCAAACCAATGCTGGCGCACAATTGCGTCCTGAAAGCATCACGCTGAGTCTGCAGTGCGCC
AGTGGACCCATCACGCTACGGAACTTGAATTTTGCCAACAGCCAGGTGTTTACCTGGTCCATGTCCAGTT
GTGCAGACACGACGCTGAGCATCGACTACCCGGGTTTTGAATTGCAGAAGCAGTGGAGTGCTGCGGGTGG
CTTCATCCAGTTCCTGAATGAGTATGCCAGCGGCGTGCGTCGCTATACGCCGGCAGATTTCCCGGGCCAG
GCCAACGCCATGAAACAGGCCGGCATCGAGTGGCTGGATATATCTTATCGCCAGCAGGGCCAGGAAAGCG
TGCTGAAAGCTTTTGCTGAAGCCGACAAACTGCATGCTCAGGCGCAGGAGATCCAGTCCAGACTTGATGC
CATGCAGCAAGAGGCGGCCGGGGCGCCTGATACGCAAAGCTCATCAGGCGCCCCGGCCTTGCCGGAGCGG
ATCATCACAACCTGCATGGGCTCTTCCGACAGTCTTGGCCCGGTGCTGACATCCAGTACAGAAACGCATG
TTCCTGAAGAGCAGACGGGGCCCGTTGCCATGCCTGAGCCCAGCGTGGCGCCGGCAGGCCAAGGCCATAG
TGCGAAGGCGTCAGGTAGGTATGCGGTTCAAGTGGGTGTCTTTGCCCACCCGGACAAGGTGCATGCAGCA
CTGGAGAAGGCGCAGTACACGCTGCAGGATGATCCCATTACCTTACATGGCAAGGAGTACAGGAACATTC
GGGTTACAGGCTATAAAACTCGCCAGGAAGCCGAGGATGCAGCCAGGCAGATAGGAAAGCTGCTGGGTTT
GAAGCCTGTTGTGGTCCAGGGCTAG
 Primer design