SecReT6
Protein ID: 332715428
SecReT6 ID438
T6SS typei5
Gene symbol-
Locus tagAGROH133_09387
StrainAgrobacterium sp. H13-3
Repliconchromosome linear [GenBank: NC_015508] [Browse all T6SS(s) in this replicon]
Location [Strand]55137..58616 [+]
ProductIcmF family protein
NoteTssM
UniProt IDF0LDB7
KEGG IDagr:AGROH133_09387
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.70E-74, Aligned region: 203..445
ImcF-related_N [PF14331], Evalue: 5.70E-74, Aligned region: 510..571
IcmF-related [PF06761], Evalue: 9.30E-67, Aligned region: 495..795
IcmF-related [PF06761], Evalue: 9.30E-67, Aligned region: 839..900
DUF1215 [PF06744], Evalue: 1.10E-32, Aligned region: 308..346
DUF1215 [PF06744], Evalue: 1.10E-32, Aligned region: 899..1020
Protein Sequence: 1159 a.a.     [Download]
>gi|332715428|ref|YP_004442894.1| IcmF family protein [Agrobacterium sp. H13-3]
MNPLSYFYTIRSYVESYAALVGRRFLSLLWVIALCVVIWFYGYLIALGDFKPLGTVQARLIAIGIIVAIW
LVYIVVTIYRGRKQDKELVDSIEREALANRQAEIGEIQTRLKEALALLRRVTKKRFGYIYDLPWYVIFGA
PGSGKTTALTNSGLQFPLGDALGENAVKGIGGTRNCNWWFADEAILIDTAGRYTTQDDLDGSSKAGWEGF
LSLLRRYRRSQPINGALVTLSIPDLLNRDPEEQRQELRSIRQRLSELDEYLRARVPVYIVLTKADLLHGF
VEFFDGFNKTDRQQVWGTTFKLDESYSAENLPQRLTEEFELLQQRVDAMLIERLQQEQNAEIRGRIFRFP
AELARLKDRLHEALAELCASSPLIEAPLLRGVYLASGTQPETERSPASPRTRRSYFLSRLFKDVIIPEAA
LVMRDKRLSGRQLLVRRIAYGASAAAVAIVFTGWIFTYFANTQALAEADRKLGAYEQLVQGIPVREVADA
DFLRILPALDNLRDANSGFARERMWNVSFGLDQEDKIAGRQRDAYQRALNALLLPRMIVQLQKQLKEEKD
VTRTFNSLKLYGMLGGMGALDRDFLTVQTHLMFASLYPGDGRAAVREALDQHAMALADGVLAPIELDARL
IATARETVRDQAIGTRAYDILAGLPQVRELMEWTPATAFGPLGERAFERRSKAPMVEGIEGLFTADGYHR
VVIPQVAHAAHIALSEGWVRGSDDAIKGATVEQVAQATLQIYFDRFEKKWVDMLADLRVKPSQTLGDAVE
TTRALANERNIVMEAARSIAKATDLRPGANPATLASAAEGDATTAVLAASVNASDPYARLRDMLATKDAA
TTGEQANGDKTGGSPSEQLLAHFKLLNEQLARSATTSDEVAKVFDVDSQLTKANQDLLQQARELPAPLDV
WVAGVAADVGSLAVKSARSRIAELWASDSASLCSSIVTGRYPFDRTSARDVAIADFTRLFGPAGVFQSFF
KQRMEPFVDKTTTPWSWKGTFGAAGLPSSAVAQFENADKISRAFFPNGSETPAVSINVKPVSLTNASSAV
MLEIEGERVVYYHGPVQAKSITWPSRENTASLSRIAFQPGGWQQAKTENGDWSPFRLFDGADIENQSDDL
LRVRFESGGQAAEFDIQFGSVLNPFKLDAIASFACPAQF
 
Nucleotide Sequence: 3480 bp     [Download]
>gi|332715374|ref|NC_015508.1|:55137-58616 Agrobacterium sp. H13-3 chromosome linear, complete sequence
ATGAATCCATTGAGCTATTTTTATACGATCCGCTCCTATGTCGAGAGCTATGCGGCCCTCGTCGGACGAC
GTTTCCTGTCGCTTTTATGGGTGATAGCGCTCTGCGTCGTCATCTGGTTCTACGGCTATCTGATTGCGCT
CGGCGATTTCAAGCCGCTTGGAACGGTGCAGGCCCGGCTCATCGCCATCGGCATCATCGTCGCCATCTGG
CTGGTCTACATCGTCGTCACGATCTACCGCGGACGCAAGCAGGACAAGGAACTCGTCGACAGTATCGAGC
GCGAGGCGCTGGCCAATCGGCAGGCGGAAATCGGCGAAATCCAGACACGCCTGAAGGAAGCGCTCGCTCT
CTTGCGACGCGTCACGAAAAAGCGCTTCGGTTATATTTACGACCTGCCCTGGTATGTGATCTTCGGCGCC
CCCGGTTCCGGCAAGACGACGGCACTCACCAATTCCGGCCTGCAATTTCCGCTTGGCGATGCGCTCGGCG
AAAATGCGGTGAAGGGCATTGGCGGCACGCGCAACTGCAACTGGTGGTTCGCCGATGAGGCGATCCTGAT
AGACACCGCCGGCCGCTATACCACGCAGGACGATCTCGACGGATCCTCAAAGGCCGGCTGGGAAGGTTTT
CTCAGCCTCCTGAGGCGATATCGCCGTTCGCAGCCGATCAACGGCGCATTGGTTACCCTCTCCATCCCCG
ATCTGCTCAACCGTGATCCCGAAGAACAGCGGCAGGAACTGCGCTCCATCCGTCAGCGGCTTTCGGAACT
CGACGAATATCTGCGCGCTCGGGTCCCGGTCTATATCGTTCTGACGAAGGCCGACCTGCTGCATGGTTTC
GTGGAGTTTTTCGACGGTTTCAACAAGACCGATCGCCAGCAGGTTTGGGGCACAACCTTCAAGCTGGATG
AGAGCTACTCCGCCGAGAACCTGCCGCAGCGCCTGACGGAAGAATTCGAGCTGCTGCAGCAGCGGGTCGA
TGCCATGCTGATTGAACGCCTGCAGCAGGAACAGAATGCGGAGATACGCGGACGCATCTTCCGTTTTCCG
GCCGAGCTGGCGCGGCTGAAAGACCGGCTGCACGAAGCCCTTGCCGAGCTTTGCGCAAGTTCGCCGCTCA
TTGAGGCGCCGCTTCTGCGCGGCGTTTATCTCGCGTCGGGAACGCAGCCGGAAACGGAAAGATCTCCCGC
ATCCCCCAGAACCCGCCGGAGCTACTTCCTCTCGCGGCTGTTCAAGGACGTCATCATCCCCGAAGCCGCA
CTGGTGATGCGCGACAAACGCCTTTCCGGGCGGCAATTGCTGGTGCGGCGCATTGCCTATGGCGCATCCG
CCGCCGCGGTCGCCATTGTCTTTACTGGCTGGATTTTCACCTATTTCGCCAATACACAGGCGCTCGCCGA
AGCGGATCGCAAACTTGGCGCTTATGAGCAACTCGTTCAGGGAATTCCCGTACGAGAGGTCGCAGATGCC
GATTTCCTGCGCATCCTCCCCGCGCTCGACAATCTGCGCGATGCCAATTCCGGCTTTGCCCGCGAACGCA
TGTGGAATGTCAGCTTCGGTCTCGATCAGGAAGACAAGATTGCCGGGCGCCAGCGTGATGCCTATCAGCG
CGCGCTCAACGCCCTGCTGCTGCCGCGCATGATCGTGCAGCTGCAAAAGCAGCTAAAGGAAGAAAAGGAT
GTCACCCGCACGTTCAATTCGCTGAAACTCTATGGAATGCTGGGCGGGATGGGTGCACTGGACCGCGATT
TCCTGACCGTGCAGACGCATCTGATGTTCGCATCGCTTTACCCTGGTGATGGACGGGCAGCGGTGCGAGA
AGCGCTTGACCAGCACGCAATGGCACTGGCCGACGGCGTGCTTGCCCCGATCGAGCTCGATGCGCGGCTC
ATCGCTACCGCCCGCGAAACGGTCCGCGATCAAGCGATCGGCACACGCGCCTATGATATTCTCGCCGGTC
TTCCACAGGTGCGCGAACTGATGGAATGGACACCCGCGACGGCTTTCGGTCCTCTTGGAGAGCGTGCTTT
CGAGCGTCGCAGCAAAGCGCCTATGGTGGAGGGCATAGAGGGCCTCTTCACTGCGGATGGATATCACCGT
GTCGTCATTCCGCAAGTCGCTCATGCCGCCCACATCGCACTTTCCGAAGGCTGGGTGCGTGGTTCTGATG
ATGCCATCAAGGGCGCGACTGTGGAGCAGGTGGCGCAGGCCACGCTACAAATCTATTTCGACCGTTTTGA
GAAAAAATGGGTTGATATGCTGGCCGACCTTCGGGTCAAACCGTCCCAGACCCTCGGCGACGCAGTGGAA
ACGACCCGCGCGCTTGCCAATGAGCGCAATATCGTGATGGAGGCTGCCAGATCGATCGCGAAGGCGACCG
ATCTCCGCCCCGGAGCAAACCCCGCCACCCTCGCCTCCGCTGCGGAAGGCGACGCAACCACAGCCGTTCT
GGCGGCCTCGGTGAATGCGTCCGATCCCTATGCGAGACTGCGCGACATGCTGGCGACTAAAGACGCAGCC
ACAACGGGCGAGCAGGCCAATGGCGACAAGACCGGTGGTTCGCCATCGGAACAGTTGCTCGCGCATTTCA
AGCTGCTGAACGAACAGCTTGCCCGCTCGGCAACAACCTCCGATGAAGTCGCCAAGGTGTTCGACGTGGA
CAGCCAGCTCACCAAGGCCAATCAGGACCTGCTGCAGCAGGCCCGCGAACTGCCGGCACCGCTCGACGTC
TGGGTGGCAGGCGTGGCAGCGGATGTCGGCTCGCTCGCGGTGAAGTCCGCTCGCAGCCGCATTGCCGAAC
TCTGGGCATCAGATTCAGCCTCCCTGTGCTCTTCGATCGTCACCGGTCGTTATCCCTTCGACCGGACTTC
CGCGCGCGATGTCGCCATTGCGGATTTCACGCGTCTCTTCGGGCCGGCAGGGGTTTTCCAGAGTTTCTTC
AAACAGCGCATGGAACCGTTTGTCGACAAGACGACGACCCCATGGAGCTGGAAGGGTACCTTTGGCGCGG
CCGGCCTTCCCAGCAGCGCCGTCGCCCAGTTCGAAAATGCCGACAAGATCTCGCGCGCCTTTTTCCCGAA
TGGTAGCGAAACGCCGGCGGTTTCGATCAATGTCAAACCCGTCTCCCTTACCAATGCATCCAGCGCGGTA
ATGCTGGAGATTGAGGGCGAGCGGGTCGTTTATTATCATGGTCCGGTCCAAGCGAAATCGATCACCTGGC
CCTCGCGCGAAAACACGGCAAGCCTGTCGCGCATCGCCTTCCAGCCCGGCGGCTGGCAGCAGGCCAAAAC
CGAAAATGGCGACTGGTCGCCCTTCCGGCTGTTTGACGGTGCCGATATCGAGAACCAGTCGGATGATCTG
CTGAGGGTGCGGTTTGAGAGTGGCGGACAGGCTGCCGAATTCGATATTCAGTTCGGCTCGGTTCTCAATC
CGTTCAAGCTGGATGCAATTGCCAGCTTCGCCTGCCCCGCGCAGTTCTAG
 Primer design