SecReT6
Protein ID: 333898463
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0258
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]292205..295723 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF6AF44
KEGG IDpfv:Psefu_0258
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.30E-99, Aligned region: 191..454
IcmF-related [PF06761], Evalue: 1.20E-87, Aligned region: 505..798
DUF1215 [PF06744], Evalue: 3.60E-39, Aligned region: 908..1031
AAA_19 [PF13245], Evalue: 0.0053, Aligned region: 128..144
AAA_22 [PF13401], Evalue: 0.0088, Aligned region: 129..150
AAA_22 [PF13401], Evalue: 0.0088, Aligned region: 409..423
AAA_22 [PF13401], Evalue: 0.0088, Aligned region: 772..819
Protein Sequence: 1172 a.a.     [Download]
>gi|333898463|ref|YP_004472336.1| type VI secretion protein IcmF [Pseudomonas fulva 12-X]
MKAFFGFMARWVMPVLGLVALALVIWFIGPLIAIGGFEPLAGTTARWTLIILLFAAWAAWRVLRIIQARR
NAARVMQGLVEVAPDPTSVATAEELATLRQRMDEALGLLKRAKLGGGERRNLYELPWYVIIGPPGSGKTT
ALANSGLRFPLAEQMGAGAVRGVGGTRNCDWWFADEAVLLDTAGRYTTQDSHAAVDKAAWLGFLDLLKKQ
RSRRPIDGAFVAISLSDLLLGSESERAAHAVAIRSRVQELYTQLGVRFPVYVMLTKLDLVPGFMEFFEGL
SKEERAQVWGMTFTLDDGKSVEGPLQVFRSEFDALEARLNERLVERLQQERDPARRDLIYGFPQQFAALR
EALAGFLDGVFKPNPYEERVLLRGVYLTSGTQEGSPIDRLIGAMAQSMSLDRQHLARQTGTGRSYFIERL
LRDVVFGERGLVGANPKVERQKRWLARGVIAATVVLVLGTAAVWFASFRANQAYIAAVDARVQPLRGELQ
ALSPAQREVLAVQPLLDAIRNVSGDAPSWAEGFGLYQGDMLDSEASSVYRKLLIAVMAPRVLARLEEQLR
AGGNSDFLYEGLKAYLMLGEAERYDADFIKAWIALDWDRSLPRDLLPEQRDALNAHLAALYDRQPPVVRL
DEHLIEDVRRQLQRLSVAQRAYDRVKRQKLPDGIPDFRISEAAGRDAALVFTRKSGKPLNEPLSGFYTQR
GYREAFLVGSVSQAGTLAEEQWVLGRSLDDGQDAAALALEVRRLYVQDYMRQWDALLADLDFVPVTSVAQ
AADVLRVLSGPTSPLKKLLQAVAKETDLQKEERLVAEKLKERGGDTVDRLKQQLGSLVGQSEEGAAQVLA
TEMDPITAHFAELNSLVEAGDGQPPAIDALLQDLNALYVQVSAMSGASGDALLGESRNQTTAAADQVRLS
AERQPPVVQGFLKSVVGSTTGTMMGGIRNQLNAAWMSEVVSVYRQSLAGRYPLDRSSSRDATLDDFGHFF
GQGGVLDSYFRRYLQPYVDTSASTWRWQPGAAQKLGIGSGVLQTFQRAASIREAFFRSGGTQPMVRFELR
PVAMDASIEQFQLDLDGQQFSYDHGPARPVAMQWPSANGTGVVRLNISPASVTGRSGITLEGPWAWFRLL
DQSDLAQGNSPDRFTLRMRVDNASISSELRASSAFNPFRRQVVSGFSLPERL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|333898208|ref|NC_015556.1|:292205-295723 Pseudomonas fulva 12-X chromosome, complete genome
GTGAAGGCGTTTTTCGGTTTCATGGCCCGTTGGGTCATGCCGGTGCTGGGCCTGGTCGCGCTGGCACTGG
TGATCTGGTTCATCGGCCCGCTGATCGCCATCGGCGGTTTCGAGCCTCTGGCGGGCACCACCGCGCGCTG
GACGCTGATCATCCTGCTGTTCGCTGCCTGGGCAGCCTGGCGGGTGCTGCGCATCATCCAGGCACGGCGC
AATGCCGCCAGGGTCATGCAGGGGCTGGTCGAAGTCGCGCCGGACCCCACCAGCGTGGCCACCGCCGAGG
AGCTGGCCACCCTGCGCCAGCGCATGGACGAGGCCCTGGGCCTGCTCAAGCGCGCCAAGCTTGGCGGCGG
CGAGCGGCGCAATCTCTACGAACTGCCGTGGTACGTGATCATCGGCCCGCCCGGTTCCGGCAAGACCACC
GCCCTGGCCAATTCCGGGCTGCGTTTCCCGCTTGCCGAGCAGATGGGCGCCGGTGCCGTACGCGGCGTGG
GCGGAACCCGCAATTGCGATTGGTGGTTCGCCGACGAGGCCGTGCTGCTCGATACTGCCGGCCGCTATAC
CACCCAGGATAGCCACGCCGCGGTCGACAAAGCCGCCTGGCTGGGCTTTCTCGACCTGCTGAAGAAGCAG
CGTTCGCGCCGGCCCATCGATGGCGCCTTCGTGGCCATCAGCCTGTCCGATCTGCTGCTCGGCAGCGAGA
GCGAGCGCGCGGCTCACGCGGTGGCCATCCGTTCCCGGGTGCAGGAGCTGTATACCCAGCTCGGAGTACG
TTTCCCGGTCTATGTGATGCTCACCAAGCTGGACCTGGTGCCCGGCTTCATGGAGTTCTTCGAGGGCCTG
AGCAAGGAAGAGCGCGCCCAGGTCTGGGGCATGACCTTTACCCTGGACGACGGCAAGAGTGTCGAAGGCC
CGCTGCAGGTGTTCCGCAGCGAGTTCGACGCGCTGGAGGCGCGCCTCAACGAGCGGCTGGTCGAGCGCTT
GCAGCAGGAACGCGATCCGGCGCGGCGCGACCTGATCTACGGCTTCCCGCAGCAGTTCGCGGCGCTGCGC
GAAGCGCTGGCCGGCTTCCTCGATGGTGTGTTCAAACCCAACCCGTACGAGGAGCGGGTGCTGCTGCGCG
GTGTGTACCTGACCAGCGGCACCCAGGAAGGCAGCCCCATCGACCGGCTGATCGGCGCCATGGCGCAGAG
CATGAGCCTGGATCGCCAGCACCTGGCGCGCCAGACCGGCACCGGGCGCAGCTACTTCATCGAACGCCTG
CTGCGTGACGTGGTGTTCGGCGAGCGTGGCCTGGTCGGCGCCAACCCCAAGGTCGAGCGGCAGAAGCGCT
GGCTGGCCCGCGGGGTGATCGCCGCGACCGTAGTGCTGGTGCTCGGCACTGCCGCCGTCTGGTTCGCCAG
CTTCCGCGCCAACCAGGCCTACATCGCTGCCGTGGATGCCCGCGTGCAGCCGCTGCGGGGCGAGCTGCAG
GCGCTCAGCCCGGCGCAGCGCGAGGTGCTGGCGGTGCAACCGCTGCTCGATGCCATCCGCAACGTCAGTG
GCGATGCGCCGAGTTGGGCCGAAGGCTTCGGCCTGTACCAGGGCGACATGCTCGATAGCGAAGCCTCCAG
TGTCTACCGCAAGCTGCTCATCGCGGTCATGGCGCCGCGGGTGCTGGCGCGTCTGGAAGAGCAGCTGCGT
GCCGGCGGCAATTCGGACTTCCTCTACGAAGGGCTCAAGGCCTACCTGATGCTCGGTGAAGCCGAACGCT
ACGACGCCGACTTCATCAAGGCCTGGATCGCCCTGGATTGGGACCGCAGCCTGCCGCGCGACCTGCTGCC
CGAGCAGCGTGACGCGCTCAACGCCCACCTGGCGGCGCTGTATGACCGCCAGCCGCCGGTGGTGCGCCTC
GACGAGCACCTGATCGAGGACGTGCGCCGCCAACTGCAGCGCCTGTCCGTCGCCCAGCGCGCCTATGACC
GGGTCAAGCGTCAGAAGCTGCCCGACGGCATCCCCGATTTCCGCATCAGCGAAGCGGCCGGGCGTGATGC
CGCGCTGGTCTTCACCCGCAAGAGCGGCAAGCCGCTGAACGAGCCGCTCAGCGGCTTCTACACCCAGCGC
GGTTACCGTGAAGCCTTCCTGGTCGGCAGCGTCAGCCAGGCCGGTACGCTGGCCGAGGAGCAGTGGGTGC
TCGGCCGCAGTCTGGACGACGGTCAGGACGCCGCCGCCCTGGCCCTGGAAGTGCGCCGCCTCTACGTGCA
GGACTACATGCGCCAATGGGATGCGCTGCTCGCCGACCTCGACTTCGTGCCGGTGACCAGCGTCGCCCAG
GCCGCCGACGTGCTGCGCGTGCTGTCCGGGCCGACTTCGCCGCTCAAGAAGCTGCTGCAGGCAGTGGCCA
AGGAAACCGACCTGCAGAAGGAAGAACGCCTGGTCGCCGAGAAGCTCAAGGAGCGCGGCGGCGATACCGT
CGACCGTCTCAAGCAACAGCTCGGCTCGCTGGTCGGGCAGTCGGAGGAGGGCGCGGCCCAGGTGCTGGCC
ACCGAGATGGACCCGATCACCGCCCACTTCGCCGAGCTCAACAGCCTGGTCGAAGCCGGCGACGGCCAGC
CACCGGCCATCGACGCGCTGCTGCAGGACCTCAACGCCCTGTACGTGCAGGTCAGCGCCATGAGTGGCGC
CAGCGGCGATGCGCTGCTGGGCGAGTCGCGCAACCAGACCACCGCTGCGGCCGACCAGGTGCGCCTGAGC
GCCGAAAGGCAGCCGCCGGTGGTGCAGGGCTTCCTGAAGTCGGTCGTGGGCTCCACCACCGGCACCATGA
TGGGCGGCATCCGCAACCAGTTGAACGCCGCCTGGATGAGCGAAGTGGTCAGCGTCTACCGCCAGTCCCT
GGCTGGGCGTTATCCGCTGGACCGCAGCAGCAGCCGAGACGCGACCCTGGACGACTTCGGTCACTTCTTC
GGCCAGGGCGGGGTGCTCGACAGCTATTTCCGTCGCTACCTGCAACCTTACGTGGACACCTCGGCCAGCA
CCTGGCGCTGGCAGCCCGGCGCCGCGCAAAAGCTCGGCATCGGCAGCGGTGTGCTGCAGACCTTCCAGCG
TGCCGCGAGCATCCGCGAGGCGTTCTTCCGCTCCGGCGGCACCCAGCCGATGGTGCGCTTCGAGCTGCGC
CCGGTGGCCATGGATGCCAGCATCGAGCAGTTCCAGCTCGACCTCGACGGCCAGCAGTTCAGCTACGACC
ATGGTCCGGCGCGCCCGGTTGCCATGCAGTGGCCGAGCGCCAACGGCACCGGCGTGGTGCGCCTGAATAT
CTCGCCGGCCTCGGTCACCGGTCGCTCGGGTATCACTCTGGAAGGACCGTGGGCATGGTTCCGCCTGCTC
GACCAGTCGGACCTCGCCCAGGGCAATTCGCCGGATCGCTTCACCCTGCGCATGCGCGTGGACAACGCCA
GCATTTCCAGCGAGCTGCGCGCCAGCAGCGCGTTCAATCCATTCCGCCGCCAGGTGGTCAGCGGTTTCAG
CCTGCCGGAGCGTTTGTGA
 Primer design