SecReT6
Protein ID: 333907056
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0667
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]728401..731775 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF6D100
KEGG IDmpc:Mar181_0667
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-42, Aligned region: 167..418
IcmF-related [PF06761], Evalue: 6.00E-42, Aligned region: 480..764
DUF1215 [PF06744], Evalue: 2.40E-16, Aligned region: 867..975
Protein Sequence: 1124 a.a.     [Download]
>gi|333907056|ref|YP_004480642.1| type VI secretion protein IcmF [Marinomonas posidonica IVIA-Po-181]
MRKEKNKAVFFLVIMLAFLILSSCALWFFDLFSMEIYWALFLEIFGVILFSALLSWICMRLFLKEKEDQA
DKKIIEFHKRRLKKVFNQAWYKQAKSNSSPYQFPWYFFISDNSEKEDVLIEKMGFEAIEGDEADVSNSPI
KFWLSDTSVLVSFSLSSKADSFQEQVDYLIQLIAKKRERQAINGVITALNVSDLLSLDDMEVSDCSKRYR
SFIKMLNNRFGLSLPIYSLFTHMAEITDFCEVFSTLDEKAREKPFGALMPVTSLKGFDKEWFDNSFDTIQ
KDLSNSISLFLTKQLNSEYRESLISGLFQINALRTDLEGFLERLFYEHHYDDKPLYFRGYFFVNAGQESS
HTDLLSMMHASDLGYQKFSTSNSNGSSLSLFNKDLVRKYIVRESKIVGVNRRKETVFRLTKTFVYSGLFC
TFIGFLVLIKANFDYQQTLDQNANIQLDQYKENLKSNVIISDDLSSPVFSVYELREIYLSYQAETPWYVT
DYLPDSSIEKVVKNAYYSELKGVLLDLMNDYLMKDMFVYSKLDDKVKSLQLLNIYQILFDPHREDVDVLV
NYYVNALTEEGEGEGLLLNRFAVLAKDLFATTAIPESKNIALVELVRSSLTSEDMSELLYQHILQHPDFR
KRIDLRKKLGPSYQDVFNFKDGYSGYLIPYLFTAEGFKDLYTSTGFELASEAIQSYEGVMGRLNGEAEIN
RINRQLRDRYIEDYIRYWKDFASNVEWVPTQGWGDSKQQLLIASDAIFSPLTYFYKLIDENTRLKFSDSA
GEDPKALVDEMLKDQKETANRVALSIQTPFAFINKLVSSDDTGQSQLGLALSQMKKTLSWVEQYKDVKSR
ELYFFEQLNDADSSNPLSLLSEMSVDYQDEILPKLLEGQAYNINNLAMKEVENKLDKDWGDVFSFYNKYL
KGRYPVSKTSSKDINISDFKAFFGDTGVVNSFLNKYQSNFDPSENDELVINSFLPNQYIVISERFKSFVT
SWKNVRSTLFDKGVPSFTFYMKAESLSPDLTKLTVSGEGSLFSYSNGPALWKKLEWPTAANVTSELMVKL
EDTEGNAYVNRVDGVWNWMRLIDLMGGARLPGSDDVSLVYKNNKSKAILRIKSDSEFSALMPDFFSGLQV
PDIL
 
Nucleotide Sequence: 3375 bp     [Download]
>ref|NC_015559.1|:728401-731775 type VI secretion protein IcmF [Marinomonas posidonica IVIA-Po-181]
ATGAGAAAAGAAAAAAATAAGGCCGTATTTTTTTTAGTGATAATGCTAGCTTTCTTAATCTTATCATCAT
GTGCGCTATGGTTTTTTGACTTGTTTTCTATGGAAATATATTGGGCTTTATTTTTAGAAATATTCGGAGT
TATATTATTTAGTGCGCTTTTATCTTGGATTTGTATGCGCTTATTTCTAAAGGAAAAAGAAGATCAGGCT
GATAAGAAAATAATTGAGTTCCATAAACGCCGCCTTAAGAAAGTGTTCAATCAAGCCTGGTATAAGCAGG
CAAAGTCGAATAGCTCTCCATACCAATTCCCTTGGTATTTTTTTATAAGTGATAACAGTGAGAAGGAAGA
TGTTTTAATAGAAAAGATGGGTTTTGAAGCGATTGAAGGCGACGAGGCCGATGTTTCTAATTCACCTATT
AAATTTTGGTTAAGTGATACTAGTGTCTTGGTATCATTTTCTCTTTCCTCTAAGGCCGATTCTTTCCAAG
AACAAGTTGATTACTTAATTCAACTGATTGCGAAAAAACGTGAAAGACAAGCTATAAATGGCGTAATAAC
AGCCTTAAATGTTTCTGACTTATTATCTTTAGATGATATGGAGGTCAGTGACTGTAGTAAGCGTTATCGT
AGTTTTATTAAAATGCTAAATAATAGGTTCGGATTATCACTTCCTATATATAGCCTTTTTACACATATGG
CCGAGATTACGGACTTTTGCGAGGTATTTTCGACGCTAGATGAAAAGGCACGAGAGAAACCATTTGGTGC
TTTAATGCCTGTCACTTCTTTAAAGGGCTTCGATAAGGAGTGGTTTGATAATAGTTTTGATACTATTCAA
AAGGACCTTTCTAACAGTATTAGTCTTTTTTTAACCAAACAATTGAATTCAGAGTATAGGGAATCGTTGA
TCTCCGGATTATTTCAAATCAATGCATTAAGAACGGATCTTGAGGGGTTCTTAGAGCGTTTGTTTTATGA
ACATCACTATGATGATAAGCCTCTATATTTTCGAGGTTATTTTTTTGTGAATGCTGGACAAGAAAGTAGT
CATACCGATCTTCTGAGTATGATGCATGCGTCAGATCTTGGTTATCAAAAGTTTTCAACATCAAATTCTA
ATGGCAGTAGCTTGAGTCTTTTTAATAAAGATTTAGTGCGAAAGTATATTGTTAGAGAGAGTAAAATAGT
TGGAGTTAACAGAAGAAAAGAAACGGTATTTAGACTTACAAAGACGTTTGTTTATTCTGGTCTATTTTGT
ACTTTTATTGGCTTTTTGGTGTTAATAAAAGCAAATTTCGACTATCAACAAACTCTAGATCAAAATGCTA
ATATCCAATTAGATCAGTATAAAGAAAACTTGAAGTCTAACGTAATAATTTCTGATGATTTATCGTCTCC
TGTTTTTAGTGTATATGAACTAAGAGAGATTTATTTATCATATCAAGCGGAAACACCTTGGTATGTGACA
GATTACCTTCCTGATTCAAGTATAGAAAAAGTTGTAAAAAATGCATATTACTCAGAGCTTAAAGGTGTCT
TACTTGATTTGATGAATGACTATTTAATGAAGGATATGTTTGTTTATAGTAAGTTGGATGATAAGGTGAA
ATCCCTTCAATTACTCAATATATATCAGATTCTTTTTGATCCGCACCGTGAAGATGTTGATGTTCTCGTT
AATTATTATGTCAATGCTTTAACTGAGGAAGGCGAAGGTGAAGGCTTGTTGTTAAACCGATTTGCCGTTC
TTGCAAAAGACCTTTTTGCAACCACAGCAATACCTGAAAGTAAAAATATAGCATTAGTTGAGCTTGTTAG
ATCTTCTTTGACATCCGAAGATATGAGTGAACTGCTGTACCAGCATATATTGCAACATCCCGATTTTAGA
AAACGTATCGATTTAAGAAAAAAATTAGGACCGTCTTATCAAGATGTATTCAATTTTAAAGATGGCTATA
GTGGCTATCTAATTCCTTACCTATTTACGGCTGAAGGTTTTAAGGATTTATATACATCCACAGGGTTTGA
ACTAGCAAGTGAAGCAATTCAATCTTATGAAGGTGTGATGGGGCGCTTAAATGGAGAAGCTGAAATAAAT
CGAATAAATCGACAACTCCGAGATCGTTATATTGAAGATTATATTCGTTACTGGAAAGACTTTGCGTCCA
ACGTAGAGTGGGTTCCAACACAAGGCTGGGGGGATTCTAAACAGCAATTATTGATAGCTTCGGATGCTAT
ATTTTCACCCTTGACGTACTTTTATAAATTGATCGATGAAAATACCAGGTTGAAATTTTCTGATTCAGCA
GGAGAAGATCCCAAAGCACTTGTGGATGAAATGCTGAAAGATCAAAAAGAAACGGCGAACCGTGTTGCAT
TGTCAATTCAAACACCTTTTGCGTTTATTAATAAACTTGTTAGTTCGGATGACACAGGGCAAAGCCAATT
AGGTTTGGCATTATCTCAAATGAAGAAGACCCTCTCTTGGGTTGAGCAATATAAGGATGTTAAAAGCCGA
GAGTTGTATTTTTTCGAACAGTTAAATGATGCGGATTCCAGTAACCCTTTATCTTTGTTATCCGAAATGT
CTGTTGATTATCAGGATGAGATTTTACCTAAATTATTAGAAGGTCAAGCTTATAATATTAATAATTTAGC
AATGAAAGAGGTCGAAAACAAATTGGACAAAGACTGGGGGGATGTTTTCTCATTTTATAATAAATATCTT
AAGGGTCGTTATCCAGTTAGTAAAACGTCTTCGAAAGACATTAATATATCAGACTTTAAAGCTTTCTTTG
GTGATACTGGGGTTGTGAATTCATTTCTTAATAAATATCAAAGTAACTTTGATCCATCTGAAAATGATGA
GCTAGTGATAAACAGCTTTTTACCGAATCAATACATAGTGATTAGTGAAAGGTTTAAAAGCTTTGTAACA
TCTTGGAAAAATGTTAGGAGCACTTTGTTTGATAAGGGGGTTCCTAGCTTTACTTTTTATATGAAAGCAG
AGTCTCTCTCTCCCGATCTGACCAAACTCACTGTTTCTGGTGAGGGGAGCTTATTCAGTTACTCTAATGG
GCCTGCATTATGGAAGAAATTAGAGTGGCCTACCGCGGCGAACGTCACCTCAGAACTTATGGTTAAACTA
GAAGATACTGAAGGTAATGCTTATGTGAATCGAGTTGATGGTGTTTGGAATTGGATGAGATTAATTGACC
TAATGGGCGGAGCCAGGTTACCAGGTTCTGACGATGTGTCTTTGGTATATAAGAATAATAAGAGCAAGGC
AATTTTACGAATTAAGTCAGACTCAGAATTTAGTGCTCTTATGCCAGACTTTTTTTCTGGGTTGCAAGTA
CCTGATATTTTGTAA
 Primer design