SecReT6
Protein ID: 333908846
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2480
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2726955..2730503 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF6CWV1
KEGG IDmpc:Mar181_2480
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.60E-84, Aligned region: 511..825
ImcF-related_N [PF14331], Evalue: 2.10E-78, Aligned region: 200..463
DUF1215 [PF06744], Evalue: 9.40E-35, Aligned region: 920..1040
Got1 [PF04178], Evalue: 0.0044, Aligned region: 15..38
Got1 [PF04178], Evalue: 0.0044, Aligned region: 449..505
Protein Sequence: 1182 a.a.     [Download]
>gi|333908846|ref|YP_004482432.1| type VI secretion protein IcmF [Marinomonas posidonica IVIA-Po-181]
MFKFIKALFGKLGSSFKVALPFLVFLIIVLVNIAIWWMGPWLEINNEFPFVSVSNRLVCMGLFSLSCCAL
WGVYQWRKFSKFKAEVEHQEVLKEDPVQAAVENQEDDLNKVIFSLKDSLNKRNYLYSLPWYLVMGLENAG
KTSLINRSGQNYTFSTVLKSSGIKSKNTYSFDWWVGDKSVLIDPDGEILTQGLNLTGSDSDGEVEKGLWL
HFLTWLEKTRSQRPLNGIVLAIDISKLATSTVYERKAYATILRSRIRELMETLSTRLPVYVALTKLDLLY
GFEAFFSNYKKDQRDDVLGFTFSLDSVESHDSWLSEFDKEYNAFIDYVNAIFPQLASESIEDEDRNAIYS
FTRQISGLKEVLSNFFEDALSSDRFSTSPLVRGVYFASVYQQGVPTNAFDDAASRRYGLTHAINKAQNAK
NSTTYFTKSLFNKIIYPEAGLASDNFRVAKQKRRIMLTSILVCSMVTVLLAASWHRFYEKNIHQSDAVIS
KVNNYLKDFPVGASLTSQEEILPPLNTIRDATLEFGFFRDKPRYISDLGLYQGHLIGPQVEITYLNLLEF
KYLPSLMADLVVDLKKAKSDEDKLAVLRVYRMLVDKSGRYDDFVLNYFSRKWQVRFSGMKEVQDKLLQHL
EYALQHTDLETLRGRGDNNAIAVLKPYEKLIASTQAELGALSIDERVYRNLKLTAQTKLGTDQDMSNLIG
PVFPLVFDQRGNSSKLRIPAMLSKKGFENYFLPSSESVSDLALIDSWVLGQTETARFSEADKQALKEKIR
ASYVADYTNSWRSAVNGFEIKDFKDINEAVNVLENLTGNSQPIIRFLSALDDNTNIFPELPEDRVALEEL
QKSTKYNIALKINAPFSDLNGMIKASDDKPANIDEVVVAIDQLKAYLKAIQDAPDVGRAALETTKARTSL
NSVDPIYTLNRISAGLPKPLDSMLTKLANQSWYVIKQEAIRYLEVRWHNDIYKVYEQKFASKYPFRADAN
SDVSLQDFEKFFAPNGTLDQFYSNQLKMFIEENLELSGELQGKSLIRDDVLAQLDQAKLIQDAFFNRKGV
LDVSFGIEPVNLTANKRRGLLNVDGQNLSYSHGPRNNVEMVWPNTLGDTALSKMTLVPTQLNFSPRSIDS
SGPWAFFRLLGMANVVSSSVSNVTYQFSIDEGLMEIRVNTEKEVNPFTRDLFKSFSLSDTLY
 
Nucleotide Sequence: 3549 bp     [Download]
>ref|NC_015559.1|:c2730503-2726955 type VI secretion protein IcmF [Marinomonas posidonica IVIA-Po-181]
ATGTTTAAGTTTATTAAGGCTTTATTTGGTAAGTTAGGTTCAAGTTTTAAGGTGGCCTTACCTTTTCTCG
TATTTTTAATCATTGTTCTAGTCAATATTGCTATTTGGTGGATGGGACCTTGGTTAGAGATTAATAATGA
ATTTCCATTCGTTAGTGTTTCTAATCGTTTAGTTTGTATGGGTCTGTTCTCCCTCTCATGCTGTGCATTA
TGGGGCGTTTATCAGTGGCGAAAATTTTCAAAATTCAAAGCCGAAGTTGAACATCAAGAGGTATTAAAAG
AGGACCCTGTTCAAGCTGCTGTAGAGAATCAAGAAGACGATTTAAATAAAGTAATTTTTAGTTTAAAGGA
CAGTCTTAATAAGCGTAACTATCTGTATAGCCTACCTTGGTATCTTGTTATGGGGCTTGAGAATGCAGGT
AAAACAAGCCTTATAAACCGCTCAGGTCAGAATTATACTTTTTCGACTGTTCTTAAATCTTCAGGCATAA
AAAGCAAGAATACTTACTCTTTTGATTGGTGGGTGGGTGATAAGTCGGTGTTAATCGATCCGGACGGTGA
GATTTTAACGCAAGGACTAAATTTAACGGGAAGTGACTCTGATGGGGAAGTTGAGAAGGGCTTATGGCTA
CACTTTCTCACATGGCTTGAGAAAACACGCAGTCAACGCCCTTTGAATGGTATCGTATTAGCGATTGATA
TTTCTAAGCTAGCCACCTCGACAGTTTATGAAAGAAAAGCTTACGCAACCATTTTAAGATCTCGAATCAG
GGAGCTAATGGAAACATTATCTACCCGTCTTCCTGTCTATGTCGCTCTCACCAAGCTTGATTTGTTATAT
GGTTTTGAAGCCTTTTTTAGTAACTATAAAAAAGACCAAAGAGATGATGTACTTGGCTTTACTTTCAGCC
TTGATTCAGTTGAAAGCCATGATTCCTGGTTAAGTGAATTTGATAAAGAATATAACGCTTTCATTGATTA
TGTGAATGCTATTTTCCCACAGTTGGCTTCTGAAAGTATTGAGGATGAAGACCGAAATGCGATATACAGC
TTTACTCGCCAAATTAGTGGTCTTAAAGAAGTATTATCCAACTTTTTTGAAGATGCGTTAAGCAGTGATC
GTTTTTCAACTTCACCCTTGGTGAGGGGGGTCTATTTTGCGTCTGTTTATCAACAGGGTGTTCCAACCAA
TGCTTTTGATGATGCGGCTTCAAGAAGGTATGGACTCACCCATGCCATTAATAAAGCCCAGAACGCTAAA
AATTCAACGACCTATTTTACAAAGAGCCTATTTAATAAAATTATTTACCCTGAAGCTGGTCTTGCATCGG
ATAACTTTCGTGTGGCAAAGCAAAAACGCCGCATCATGTTAACCAGTATCTTAGTTTGCAGTATGGTTAC
CGTATTACTAGCGGCTTCATGGCATAGATTTTATGAAAAGAATATTCATCAGTCTGATGCTGTTATTAGT
AAAGTAAATAACTATTTAAAAGATTTCCCTGTAGGGGCATCTCTTACTTCTCAAGAAGAGATACTTCCAC
CACTTAATACCATTCGAGATGCGACGTTAGAATTCGGTTTTTTCCGCGATAAGCCACGTTATATCTCCGA
TTTAGGACTATATCAAGGTCATCTGATCGGTCCCCAGGTTGAAATTACTTACTTGAATTTATTGGAGTTT
AAATACCTTCCTTCTCTCATGGCTGATCTTGTCGTTGATCTAAAGAAAGCCAAAAGTGATGAAGATAAGC
TTGCTGTCCTTAGGGTATATCGAATGCTTGTTGATAAAAGTGGTCGATATGACGACTTTGTTCTCAATTA
CTTTTCGCGAAAGTGGCAGGTTCGGTTTTCTGGAATGAAAGAGGTTCAAGATAAATTATTGCAACATCTT
GAATACGCCTTACAACATACTGACCTTGAGACGCTAAGGGGGAGAGGAGACAATAATGCCATAGCGGTTC
TTAAGCCTTATGAAAAGCTGATTGCCTCTACTCAGGCTGAATTAGGTGCCCTTTCTATTGATGAGCGTGT
CTACAGAAACCTTAAATTAACCGCGCAAACCAAACTTGGTACAGACCAAGATATGAGTAACTTAATTGGG
CCAGTTTTTCCATTGGTGTTTGATCAAAGGGGCAACTCAAGTAAGTTACGAATTCCTGCCATGTTATCTA
AAAAGGGCTTTGAGAATTACTTCTTACCGAGCTCGGAATCTGTTTCTGATCTGGCTTTGATTGATAGTTG
GGTACTTGGCCAAACCGAGACAGCTCGGTTTAGTGAGGCTGATAAGCAAGCATTGAAGGAGAAAATCCGA
GCGTCTTATGTTGCGGATTACACTAATTCATGGCGTTCAGCGGTTAATGGTTTTGAAATTAAAGATTTTA
AAGACATTAATGAAGCCGTAAACGTGTTAGAGAACCTAACCGGTAACTCGCAGCCAATCATACGGTTTTT
ATCTGCTTTAGACGATAACACGAATATTTTCCCTGAATTGCCAGAGGATAGAGTAGCGTTAGAAGAGCTA
CAGAAAAGCACTAAGTACAATATCGCCCTTAAAATCAATGCTCCTTTTTCTGATTTGAACGGCATGATCA
AAGCCAGTGACGATAAGCCTGCTAACATAGATGAAGTGGTCGTCGCGATTGATCAGTTAAAAGCCTATCT
GAAAGCCATTCAGGATGCACCTGATGTTGGTAGAGCGGCACTTGAGACAACAAAAGCTAGAACGTCTTTG
AACAGTGTTGATCCGATTTATACATTGAACAGGATTTCAGCAGGCTTGCCGAAACCGCTTGACTCCATGT
TAACTAAATTGGCAAATCAAAGTTGGTATGTCATTAAACAGGAAGCCATCCGTTATCTGGAAGTAAGGTG
GCATAATGATATTTATAAAGTCTATGAACAAAAATTCGCGAGTAAATACCCTTTCCGTGCCGATGCTAAT
AGCGATGTGTCACTGCAAGACTTTGAAAAATTCTTTGCGCCAAATGGTACGTTAGATCAGTTCTACAGCA
ATCAGCTTAAAATGTTTATTGAAGAAAACTTAGAGCTAAGCGGCGAATTGCAAGGCAAGTCTCTTATTCG
TGATGATGTATTGGCTCAGCTGGATCAAGCTAAATTGATTCAAGATGCATTCTTTAATAGGAAAGGCGTT
TTAGACGTATCCTTCGGAATTGAGCCTGTTAACTTGACGGCCAATAAACGAAGAGGTTTGTTAAATGTTG
ATGGCCAAAATCTTTCATACAGTCATGGACCTAGGAATAACGTCGAAATGGTATGGCCAAATACCTTAGG
AGATACTGCTCTTTCTAAGATGACGCTGGTACCAACACAGCTTAACTTTTCTCCAAGGAGTATCGACTCC
TCAGGACCTTGGGCTTTTTTCCGCTTACTGGGTATGGCAAATGTGGTGAGTTCGAGTGTTTCAAATGTGA
CCTATCAGTTTAGTATTGATGAGGGTTTAATGGAAATACGAGTGAACACAGAGAAAGAAGTAAACCCGTT
TACACGCGATTTATTCAAATCTTTCAGTTTATCGGACACTTTGTACTAG
 Primer design