SecReT6
Protein ID: 333914606
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2976
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3353898..3357554 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF6AQK8
KEGG IDdel:DelCs14_2976
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-97, Aligned region: 205..476
IcmF-related [PF06761], Evalue: 4.40E-93, Aligned region: 525..838
DUF1215 [PF06744], Evalue: 5.20E-33, Aligned region: 955..1078
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 45..94
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 472..534
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 545..623
DUF4381 [PF14316], Evalue: 0.0014, Aligned region: 793..831
AAA_16 [PF13191], Evalue: 0.0037, Aligned region: 140..267
AAA_16 [PF13191], Evalue: 0.0037, Aligned region: 657..657
Protein Sequence: 1218 a.a.     [Download]
>gi|333914606|ref|YP_004488338.1| type VI secretion protein IcmF [Delftia sp. Cs1-4]
MIRRIASWLFNRYMLELLGLVALSLLIWFVGPLVFIQPYQPLGSPTVRWWIIAGLFILWFLRLLLRWWRA
QRMNEHLMTGLARLTSPREADGTPAAGSEEVAELESRFKEALDTLSKTRFGQTEGGLFGRWNKRYIYQLP
WYLIIGSPGSGKTTALINSGLDFPLAAQFGKRAIPGIGGTRNCDWWFTDQAVLLDTAGRYTTQESDAEQD
KAAWKGFMQLLKRFRGRQPVNGVIVTLSVQELLSASDAERAQLAQLIGLRLSELCEELTIRFPVYVLVTK
SDLLAGFNEFFGAMSREERAQVWGFTYPYDEKTQRSPASDPQAASALYMEEFDALVAQINRLLPQRLMTE
PDLARRSLLYALPQQFAGLKDVVRDTLDAAFSASRFKEKPLLRGVYFTSGTQEGMPFDRVMSALSRRFAL
RGRLPADAVPQQGRSYFLESLFKDVMFNESGLTGRNAKKERQLRLMQAAGLCALLLALGGAALAWTLSYE
NNQRYLNEVADNAGTLRQAVEESKATDPDNVVALVPMLNHAARVAQSSRFEESAPLGWRWGLLQVPKVQT
AAHATYLRLLEDAWLPRLSSHVARSLRQVSTGSPEASYETLKAYLMLYEPDHFDATFVKAWLRSDWENTL
PQHLVQAGLVDQLSEHLDRLIDGRVVVSAQPIDANLVAEVRQRLAQMSPAQRAYSRLKQLLNTGDKLPPD
FSVVRASGPEAPQVFARASGKPLTQGISGLFTYDGYHGLFLHELPKVTTLLAKEETWVLGQAEGRRSVAQ
EVLTGQLANEVKRLYLMEYARLWETFLADIRPIRTASLEQAGEQARLYSSANSSLEQFIRAVARETTLAR
RPDQQEGGSSGSTSSWLGEKLQRIREEQHQLSRLTGKPLNVGGMLATGTLEADIVDFRFREYRRLATSNG
SGPAPITASLQVLNEAAAVIASARQQVIQGGGVPPSLSGTLEKVRSEAKRVPPPLNSMYEALATSTSSFV
GSSVRSTLGGNLNATIGDFCRRAILGRYPFTRSATRDVTTDDFARLFATGGTMDEFFRTQLQTMVNISTV
PWTFKQGVDGTPVGGSASLAAFQRAASIRDVFFRAGGNTPGIRLEIKPLDMDASISQMVLDVDGEIVRYQ
HGPQIPKAVSWPGTRGTGQARLQITAAGAQNTGIVTEGPWALHRLFDRAQILPGNSPERFTAIFTIDGRK
LRMEVTTSSVLNPFRLKAMEEFECPDRL
 
Nucleotide Sequence: 3657 bp     [Download]
>ref|NC_015563.1|:c3357554-3353898 type VI secretion protein IcmF [Delftia sp. Cs1-4]
ATGATCCGTCGCATCGCCTCATGGCTGTTCAACCGCTACATGCTGGAGCTTCTGGGCCTGGTGGCCCTGA
GCCTGCTCATCTGGTTCGTCGGCCCGCTCGTCTTCATCCAGCCCTACCAGCCGCTGGGCAGCCCCACCGT
GCGCTGGTGGATCATTGCCGGCCTGTTCATCCTCTGGTTCCTGCGCCTGCTGCTGCGCTGGTGGCGCGCA
CAGCGCATGAACGAGCACCTCATGACCGGCCTGGCCCGCCTGACCTCGCCGCGCGAGGCGGACGGCACGC
CCGCAGCAGGCTCCGAGGAAGTGGCCGAGCTGGAGTCGCGCTTCAAGGAAGCCCTGGACACGCTGAGCAA
GACCCGCTTCGGCCAGACCGAAGGCGGCCTGTTCGGCCGCTGGAACAAGCGCTACATCTACCAGCTGCCC
TGGTACCTGATCATCGGCTCGCCGGGTTCGGGCAAGACCACGGCCCTGATCAACTCGGGGCTGGACTTCC
CGCTGGCGGCCCAGTTCGGCAAGCGCGCCATCCCCGGCATAGGCGGCACGCGCAACTGCGACTGGTGGTT
CACCGACCAGGCCGTGCTGCTGGACACGGCCGGCCGCTACACCACCCAGGAAAGCGATGCGGAGCAGGAC
AAGGCAGCCTGGAAGGGCTTCATGCAGCTGCTCAAGCGCTTTCGCGGACGCCAGCCCGTCAACGGCGTGA
TCGTCACGCTCAGCGTGCAGGAGCTGCTCAGTGCCAGTGACGCCGAGCGCGCCCAGCTGGCCCAGCTGAT
CGGCCTGCGCCTGAGCGAGCTGTGCGAGGAGCTGACCATCCGCTTCCCCGTCTACGTGCTGGTCACCAAG
AGCGACCTGCTGGCGGGCTTCAACGAGTTCTTCGGCGCCATGAGCCGCGAGGAGCGCGCCCAGGTCTGGG
GCTTCACCTATCCCTATGACGAAAAGACCCAGCGCTCGCCCGCCAGCGACCCGCAGGCCGCCAGCGCCCT
GTACATGGAGGAGTTCGACGCACTGGTCGCCCAGATCAACCGCCTGCTGCCCCAGCGGCTGATGACCGAG
CCCGATCTTGCGCGCCGCAGCCTGCTCTACGCACTGCCCCAGCAGTTTGCCGGCCTCAAGGACGTGGTGC
GCGACACGCTGGATGCGGCGTTCTCCGCCTCGCGCTTCAAGGAAAAGCCGCTGCTGCGCGGCGTCTACTT
CACCAGCGGAACGCAGGAGGGCATGCCCTTCGACCGCGTGATGTCGGCCCTGTCGCGCCGCTTTGCGCTG
CGTGGCCGCCTGCCGGCCGATGCCGTGCCGCAGCAGGGCCGCAGCTACTTCCTGGAGTCGCTGTTCAAGG
ACGTGATGTTCAACGAGTCCGGCCTGACCGGGCGCAACGCCAAGAAAGAGCGCCAGCTGCGCCTGATGCA
GGCCGCCGGCCTGTGCGCGCTGCTGCTGGCCCTGGGCGGCGCGGCCCTGGCCTGGACGCTGAGCTACGAG
AACAACCAGCGCTACCTGAACGAAGTGGCCGACAACGCCGGCACGCTGCGCCAGGCCGTGGAGGAATCCA
AGGCCACCGACCCCGACAACGTGGTCGCCCTGGTGCCCATGCTCAACCACGCGGCGCGCGTGGCGCAGAG
CAGCCGCTTCGAGGAATCGGCCCCGCTGGGCTGGCGCTGGGGCCTGCTGCAGGTGCCCAAGGTGCAGACG
GCCGCCCACGCCACCTACCTGCGCCTGCTGGAAGACGCCTGGCTGCCGCGCCTGAGCAGCCATGTCGCGC
GCTCGCTGCGCCAGGTCAGCACCGGCAGCCCCGAGGCCAGCTACGAAACGCTCAAGGCCTATCTCATGCT
CTATGAGCCCGACCACTTCGACGCCACCTTCGTCAAGGCCTGGCTGCGCAGCGATTGGGAAAACACCCTG
CCCCAGCATCTGGTGCAGGCCGGCCTGGTGGACCAGCTGTCCGAGCACCTGGACCGCCTCATCGACGGCC
GCGTGGTGGTCTCCGCCCAGCCCATCGACGCCAACCTGGTCGCCGAAGTGCGCCAGCGCCTGGCCCAGAT
GTCGCCCGCCCAGCGCGCCTACAGCCGCCTCAAGCAGCTGCTGAACACCGGCGACAAGCTGCCGCCCGAC
TTCAGCGTGGTGCGTGCCAGCGGGCCCGAGGCGCCCCAGGTCTTTGCGCGTGCCAGCGGCAAGCCGCTCA
CCCAGGGCATCAGCGGCCTGTTCACCTATGACGGCTACCACGGCCTCTTCCTGCACGAGCTGCCCAAGGT
CACCACCTTGCTGGCCAAGGAGGAAACCTGGGTGCTGGGCCAGGCCGAAGGCCGGCGCAGCGTGGCCCAG
GAAGTGCTCACGGGCCAGCTGGCCAACGAGGTCAAGCGCCTGTACCTGATGGAGTACGCGCGCCTGTGGG
AAACCTTCCTGGCCGACATCCGCCCCATACGCACGGCCTCGCTGGAGCAGGCCGGCGAGCAGGCCCGCCT
GTACTCGTCCGCCAACTCCAGCCTGGAGCAGTTCATCCGCGCCGTGGCCCGCGAGACCACGCTGGCCCGC
CGCCCGGACCAGCAGGAAGGCGGCAGCTCGGGCAGCACCAGCAGCTGGCTGGGCGAGAAACTGCAGCGCA
TCCGCGAGGAACAGCACCAGCTCAGCCGCCTGACCGGCAAGCCGCTGAACGTGGGCGGCATGCTGGCCAC
CGGCACGCTGGAGGCCGACATCGTGGACTTCCGCTTCCGCGAATACCGGCGCCTTGCCACCAGCAACGGC
TCGGGCCCGGCGCCCATCACCGCCAGCCTGCAGGTGCTCAACGAGGCTGCGGCCGTCATCGCCTCGGCGC
GCCAGCAGGTGATCCAGGGCGGCGGCGTGCCTCCCTCGCTGAGCGGCACGCTGGAGAAGGTGCGCTCGGA
AGCCAAGCGCGTGCCGCCTCCGCTCAACAGCATGTACGAGGCCCTGGCCACGTCCACCTCGTCCTTCGTG
GGAAGCAGCGTGCGCAGCACGCTGGGCGGCAACCTCAACGCCACCATCGGCGACTTCTGCCGCCGGGCCA
TCCTGGGCCGCTACCCCTTCACGCGCAGCGCCACGCGCGACGTGACCACGGACGACTTCGCCCGCCTGTT
CGCCACCGGCGGCACCATGGACGAGTTCTTCCGTACCCAGCTGCAGACCATGGTGAACATCTCCACCGTG
CCCTGGACCTTCAAGCAGGGTGTGGACGGCACGCCGGTAGGAGGCTCTGCCTCGCTGGCCGCCTTCCAGC
GCGCGGCCTCCATCCGCGACGTGTTCTTCCGCGCAGGCGGCAACACGCCCGGCATCCGGCTGGAGATCAA
GCCGCTGGACATGGACGCCTCCATCTCCCAGATGGTGCTGGACGTGGACGGCGAAATCGTGCGCTACCAG
CACGGCCCGCAAATCCCCAAGGCCGTCTCCTGGCCGGGCACGCGCGGCACCGGCCAGGCCCGGCTGCAGA
TCACGGCCGCCGGCGCCCAGAACACCGGCATCGTGACCGAAGGCCCCTGGGCGCTGCACCGCCTGTTCGA
CCGTGCCCAGATCCTGCCGGGCAACTCGCCCGAGCGTTTCACGGCCATCTTCACCATCGACGGACGCAAG
CTGCGCATGGAAGTCACCACCAGCAGCGTCCTCAACCCATTCCGGCTCAAGGCCATGGAGGAATTCGAAT
GTCCGGACCGGCTGTGA
 Primer design