SecReT6
Protein ID: 333985097
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3439
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3800885..3802150 [-]
Productserine-type D-Ala-D-Ala carboxypeptidase
NoteSPOR
UniProt IDG0A714
KEGG IDmmt:Metme_3439
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S11 [PF00768], Evalue: 3.90E-59, Aligned region: 24..246
Beta-lactamase2 [PF13354], Evalue: 8.10E-14, Aligned region: 36..188
Beta-lactamase [PF00144], Evalue: 0.002, Aligned region: 30..105
Beta-lactamase [PF00144], Evalue: 0.002, Aligned region: 140..172
Protein Sequence: 421 a.a.     [Download]
>gi|333985097|ref|YP_004514307.1| unnamed protein product [Methylomonas methanica MC09]
MKHPLNIKTGSLAGALLLLTSLPALARYAAIVIDADSGRVVHEVEATHRWYPASLTKVMTIYMTFAAIEA
GRLHLHDTLTVSAHAARQPSSKLGLRQGQTISVEHAIMAVTTRSANDAAVVLAERLGGSESQFAGMMTQQ
AQRMGMYNSSFQNASGLPDEGQISSARDLALLSSALIRDFPQYYRYFSATEFAYKGRVLPNTNKILKTYP
DADGLKTGFTCGSGYNLIASAKRNGRRLIGVLLGAHSSAERFQQMANLLDLGFEKSQVGAFGMPVTQLRD
ANFAPPPFQLSSNRCAGSAEQMGADSGSGRSEPIRIKPGKSTRLADNRRVKTKSAKGGAANGNWTVMLGD
HRRKIDADVNLKQARYALGTAAKTGQPHVVRIKTKGKLLWRTEWMNLSSSQARDFCRKLRAKGRQCTLLP
G
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3802150-3800885 Methylomonas methanica MC09 chromosome, complete genome
TTGAAACACCCGTTAAACATTAAAACCGGCAGCTTGGCCGGCGCTTTGTTATTACTGACGAGCTTGCCCG
CGTTGGCGCGTTATGCGGCAATAGTCATCGATGCCGATAGCGGGCGTGTAGTGCACGAGGTGGAGGCGAC
ACATCGCTGGTACCCGGCTTCCCTGACCAAAGTGATGACAATTTACATGACGTTTGCCGCTATCGAAGCC
GGCCGTTTGCATCTGCATGACACCCTGACCGTATCGGCGCATGCGGCCCGGCAGCCGAGTTCCAAATTAG
GCTTGCGGCAAGGGCAGACTATCAGCGTCGAACATGCCATTATGGCCGTGACTACCCGTTCCGCAAACGA
TGCCGCGGTGGTGTTGGCGGAGCGCTTGGGCGGCAGCGAGTCGCAATTCGCCGGCATGATGACCCAGCAG
GCGCAACGCATGGGTATGTACAATAGTTCGTTCCAAAATGCCAGCGGTTTGCCGGACGAAGGCCAAATCA
GCAGCGCACGCGATTTGGCCTTGCTTTCCTCTGCCTTGATTCGGGATTTTCCGCAATATTACCGCTATTT
TTCGGCCACGGAATTCGCCTATAAAGGCCGGGTTTTGCCGAATACCAACAAAATATTGAAAACCTATCCG
GATGCGGACGGCTTGAAAACCGGCTTTACTTGCGGTTCCGGCTACAACCTGATTGCGTCGGCCAAGCGTA
ACGGCCGCCGCTTGATCGGGGTGTTGTTGGGGGCGCATAGCAGCGCCGAGCGTTTCCAGCAAATGGCTAA
CTTATTGGATCTCGGTTTTGAAAAGTCCCAGGTGGGCGCATTCGGCATGCCGGTAACCCAGTTAAGAGAC
GCCAATTTCGCCCCGCCGCCGTTCCAGCTGTCGTCCAATCGTTGCGCCGGCAGCGCCGAACAGATGGGGG
CGGATTCCGGTTCCGGTCGCTCGGAACCCATTCGCATCAAGCCCGGCAAATCCACCCGCTTGGCCGATAA
CCGCAGGGTTAAAACCAAAAGCGCAAAGGGCGGTGCGGCCAACGGAAATTGGACCGTCATGCTGGGCGAC
CACCGCCGCAAAATCGACGCCGATGTCAACTTGAAGCAAGCGCGTTATGCCTTGGGTACGGCCGCAAAAA
CCGGTCAACCGCATGTGGTCAGAATCAAAACCAAGGGCAAACTGCTGTGGCGCACGGAATGGATGAACTT
GAGCTCAAGCCAAGCCAGGGATTTCTGCAGGAAATTGCGAGCTAAAGGAAGGCAGTGCACCCTGTTGCCG
GGTTAA
 Primer design