SecReT6
Protein ID: 333985100
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3442
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3805083..3808628 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG0A717
KEGG IDmmt:Metme_3442
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.50E-93, Aligned region: 193..454
IcmF-related [PF06761], Evalue: 3.00E-70, Aligned region: 300..325
IcmF-related [PF06761], Evalue: 3.00E-70, Aligned region: 513..804
DUF1215 [PF06744], Evalue: 2.10E-31, Aligned region: 688..735
DUF1215 [PF06744], Evalue: 2.10E-31, Aligned region: 924..1042
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 128..256
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 410..426
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 559..624
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 782..823
AAA_10 [PF12846], Evalue: 0.008, Aligned region: 131..288
AAA_10 [PF12846], Evalue: 0.008, Aligned region: 411..449
Protein Sequence: 1181 a.a.     [Download]
>gi|333985100|ref|YP_004514310.1| unnamed protein product [Methylomonas methanica MC09]
MGKLKAFFTNKWVIQFLGLLAFSILIWLAGPLIAFAGSAPLESELVRILVIATVFVGWVIFRLIMQIRAG
NTEKQLVEELVANDADQVAMASEDEVDTLRKGFEEALTVLKQSRTEAKSGSQYIYQLPWYAIIGAPGSGK
TTALINSGLHFPLAEKLGKHAIKGVSGTRNCDWWFADDAVFLDTAGRYTTQESHQAVDAAGWAGFLNLIK
KHRPLRPLNGVIVATSISDLLQQSEQERVEHAKAIRNRINELYQQLGVRLPVYLLFTKADLVAGFSDFFA
DLAPEQRAQVWGETFSATTLQGDHDVVTQFGDAYAELLQRLQMRTLNRIQDERDMQRRGAILDFPQQMAL
LKPAMLDFLQATFAVNRYEQAVLLRGVYFTSGTQEGTPIDRVLGILASAFRLDRQAAPMYSGQGKSFFLT
RLLKDVLFPEAELAGQDPKLAKRKRLMQMAAYIGSGLLFLLVIGLWTASYFNNQSILDKVEAQIAEYHAI
KSSGSDSQGNFNALLPRLNILLAIQEDYKDSGIMSRFGLSQADKIQAAAQHSYETILRNYFLPAIQMRLK
ERMQGPEANNLDVLYQLLKVYLMFNQTDKLDPATAVAWIRADWDRQYATDPESLGQLVLHLDNLLKLQLD
PMQIDEGFVGAVRNKLTQVPLIGQIYSRFKTEALIDQSHDFKLGKALGPDTTRVFVLSDGKDVSAYTIPG
LFTAYGYTELFLKKSRDFVKDAVEQNWVLGSQSKADVLQIQQLHGELKKLYLNEYQAAWSDLLAKLKLQS
AVTTNQTAQILDILSRPDGPLHALLVSIDENTALTRLNKQVSDALANVAGKALAAAGAAGGQALALAQDA
AGLDTGPDPVQMVEDKFEPLRNLVAGGPDKPSALDPVLQQLKSLRDYFLQLSTANTGGQALQNQANLFSG
AGMDVLKQAQLEFARLPEPLKTWFQIIVNSGGNKLSSAAKAQLSDMVKTGVASPCKAALNGRYPFSSASS
QDVLLADFAKLFAPSGLIDQFFQANLKTFVDTTKPVWTEMAAEKPLGLSQASIRQFQTASKIRDAFFAVG
NMPQVQFELKPQLLDNNVGTFRLQVEGQEAVYRHGPEQSISMKWPGPNPSQGVRIVFETLDGRQVSRGKE
GTWAFFRLLDEATIVQGNAPERFTLTFKLQGMSASYQLLAASVNNPFNLQELQSFRCPDAL
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3808628-3805083 Methylomonas methanica MC09 chromosome, complete genome
ATGGGCAAGCTCAAAGCATTTTTTACCAATAAATGGGTTATTCAGTTTCTGGGTTTGCTGGCGTTCAGTA
TCCTGATCTGGCTGGCCGGGCCGTTGATAGCCTTCGCGGGCAGTGCGCCGCTGGAGTCGGAACTGGTCAG
GATTTTGGTCATCGCCACCGTGTTTGTCGGCTGGGTGATTTTCCGGCTGATCATGCAGATTCGGGCGGGT
AATACCGAAAAACAACTGGTCGAGGAATTGGTCGCCAACGATGCCGATCAGGTCGCCATGGCGTCCGAAG
ATGAAGTGGATACGCTACGCAAAGGCTTTGAGGAAGCATTGACGGTGTTGAAGCAATCGCGCACCGAAGC
AAAATCCGGCAGCCAGTATATTTATCAATTACCCTGGTATGCCATCATCGGTGCGCCCGGTTCCGGTAAA
ACCACGGCCTTGATCAACTCCGGTTTGCATTTTCCACTGGCGGAAAAACTGGGCAAGCATGCGATAAAAG
GCGTCAGCGGCACCCGAAATTGCGATTGGTGGTTTGCCGACGACGCGGTGTTTCTGGATACGGCCGGCCG
CTATACCACGCAGGAAAGCCATCAAGCCGTGGATGCGGCCGGATGGGCCGGCTTTTTGAATCTGATCAAA
AAGCATCGGCCGCTACGCCCCCTGAACGGAGTCATCGTCGCCACCAGTATTTCCGATCTGTTGCAGCAAT
CCGAGCAGGAACGGGTCGAACATGCCAAAGCCATTCGCAACCGCATCAACGAGTTGTATCAACAGCTGGG
CGTGCGTTTGCCGGTGTATTTGCTGTTTACCAAAGCCGATTTGGTAGCCGGATTCAGCGACTTTTTCGCC
GATTTAGCCCCGGAGCAGCGGGCTCAAGTGTGGGGGGAAACCTTTTCCGCCACCACCTTACAGGGCGATC
ACGATGTAGTGACTCAATTCGGCGACGCTTATGCGGAATTACTGCAACGTTTGCAAATGCGCACGCTCAA
TCGTATTCAGGATGAACGCGATATGCAACGTCGGGGAGCCATCCTGGATTTTCCGCAGCAGATGGCTTTA
TTAAAGCCGGCCATGCTGGATTTTTTGCAGGCAACCTTTGCGGTCAATCGCTACGAGCAAGCCGTGTTAT
TGCGGGGGGTGTATTTCACCAGCGGCACCCAGGAAGGCACGCCCATCGACCGGGTATTGGGTATTCTGGC
CAGCGCCTTTCGTCTGGATAGGCAAGCCGCGCCTATGTATAGCGGTCAAGGTAAAAGCTTTTTCCTGACC
CGTTTGTTAAAGGATGTATTGTTTCCGGAAGCGGAGCTGGCCGGACAAGATCCCAAATTGGCCAAACGCA
AACGCTTGATGCAAATGGCCGCTTATATCGGTTCCGGTTTGCTGTTTTTGCTGGTGATCGGTTTGTGGAC
CGCCAGTTATTTCAACAACCAATCGATACTGGATAAGGTGGAGGCGCAAATCGCCGAATACCACGCCATC
AAAAGCAGTGGCAGCGATAGCCAAGGCAATTTCAATGCCTTGTTGCCGCGCTTGAATATTTTGCTGGCCA
TACAGGAAGATTACAAAGACAGTGGCATCATGTCCAGGTTCGGCCTATCGCAAGCCGATAAAATTCAGGC
AGCCGCCCAGCATAGTTACGAAACCATCCTGCGTAATTATTTTTTACCCGCGATTCAGATGCGTTTGAAA
GAACGCATGCAAGGACCCGAAGCCAATAATCTGGACGTGCTCTACCAGCTGTTAAAAGTCTATTTAATGT
TCAACCAGACCGATAAACTCGATCCCGCTACCGCTGTGGCCTGGATCCGCGCGGATTGGGACAGACAATA
CGCGACCGACCCGGAAAGTCTGGGGCAGTTGGTGCTGCATCTGGATAATCTGCTCAAGCTGCAGCTGGAC
CCGATGCAGATCGATGAAGGGTTTGTCGGCGCGGTGCGTAACAAGCTCACGCAAGTGCCGCTGATCGGGC
AGATTTACTCCCGCTTCAAAACCGAGGCCTTAATAGACCAAAGCCACGATTTTAAGTTGGGTAAAGCATT
GGGGCCGGATACCACTCGGGTATTCGTGTTGTCGGACGGCAAAGATGTGTCGGCTTATACCATTCCGGGC
TTGTTTACGGCCTATGGCTACACCGAGTTGTTTCTAAAAAAAAGCCGGGATTTCGTCAAGGACGCTGTAG
AACAGAATTGGGTGCTGGGTAGCCAGTCCAAAGCCGACGTTTTGCAAATTCAGCAATTACACGGCGAATT
GAAGAAACTGTATTTAAACGAATACCAGGCGGCTTGGTCTGATTTGCTGGCTAAATTGAAATTACAATCG
GCGGTCACGACCAATCAGACCGCGCAAATCCTGGACATTTTGTCGAGGCCCGACGGTCCTCTGCACGCCT
TGTTGGTCAGTATCGATGAAAATACCGCGCTAACCCGCTTGAATAAGCAAGTGAGCGATGCACTGGCCAA
TGTTGCCGGAAAAGCGTTGGCTGCCGCAGGTGCGGCAGGCGGCCAAGCGTTGGCGCTGGCGCAGGATGCC
GCAGGCCTGGATACCGGCCCAGACCCGGTGCAGATGGTGGAAGACAAGTTTGAACCCCTGCGCAATCTGG
TAGCCGGCGGACCGGACAAGCCGAGCGCCTTGGACCCGGTATTGCAGCAATTGAAAAGTCTGCGCGATTA
CTTTCTGCAACTCAGCACTGCCAATACCGGCGGTCAGGCGTTACAAAATCAGGCCAATTTATTCAGCGGC
GCCGGTATGGATGTACTGAAACAGGCGCAATTGGAGTTTGCCCGCTTGCCGGAACCCTTGAAAACCTGGT
TCCAGATTATCGTCAATAGCGGCGGCAATAAGCTGTCTTCCGCCGCCAAGGCTCAGTTGAGCGATATGGT
GAAAACCGGGGTGGCGTCGCCTTGCAAGGCGGCATTGAACGGCCGTTATCCGTTTTCCAGCGCTTCCTCG
CAGGATGTGTTATTGGCCGATTTTGCCAAACTGTTTGCGCCGTCCGGTTTGATCGACCAGTTTTTTCAAG
CCAATCTGAAAACCTTTGTCGACACCACCAAGCCGGTGTGGACGGAAATGGCCGCCGAGAAACCGCTCGG
TTTGTCGCAAGCCTCGATTCGTCAATTTCAAACTGCCTCCAAAATACGCGATGCTTTTTTTGCTGTCGGC
AACATGCCGCAAGTGCAATTCGAATTAAAGCCGCAATTGTTGGATAACAATGTCGGCACCTTTCGCTTGC
AGGTGGAAGGGCAAGAGGCTGTGTATCGTCACGGTCCCGAACAATCCATCAGCATGAAATGGCCCGGCCC
TAACCCCAGTCAGGGCGTGCGCATCGTGTTTGAAACGCTGGACGGACGTCAGGTCAGTCGCGGCAAGGAA
GGCACCTGGGCATTTTTTCGCTTGCTGGATGAAGCCACCATTGTGCAGGGCAACGCCCCGGAACGGTTTA
CCCTTACCTTCAAATTGCAGGGTATGAGCGCCAGTTACCAACTGCTGGCCGCCAGCGTTAACAATCCCTT
TAATTTACAGGAACTGCAAAGTTTCCGTTGCCCCGATGCCTTGTGA
 Primer design