SecReT6
Protein ID: 333985101
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3443
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3808637..3810025 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDG0A718
KEGG IDmmt:Metme_3443
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.30E-65, Aligned region: 79..282
OmpA [PF00691], Evalue: 6.70E-13, Aligned region: 120..137
OmpA [PF00691], Evalue: 6.70E-13, Aligned region: 356..455
Protein Sequence: 462 a.a.     [Download]
>gi|333985101|ref|YP_004514311.1| unnamed protein product [Methylomonas methanica MC09]
MSENDPFGPFGDDDRTVIRPMPGGRRPAPAPAQTPPVQPAQPAPAYAAPPPPLNPAPAPMPGFNPSAPVA
LPTTEFQQNPMVAAALSMISLASRLRQTAVYPAVDELRQRLSAEVSGFENKLLQTGIGADQVRMASYALC
SFLDETILNTPWGSQSNWGHQSLLISFHKEAWGGEKFFDIIGMLVKQPAQNLNLIELAYLFLSLGFQGKF
RILSNGLNELEKYRLELYQLIARVKGDYERELSPRWQGLRDVRNALVRYVPLWVVGAVLGVALILTYIGF
VLALNARSDQLFAELFGLGKQPIEIAQAAAVIPLPAPVPKPVVPERRERFKQLLAKEIAADMVEVVDDKL
LRIRNSFASGSDQLKPQFEPMLKKISDELVAGNDRVLVTGHTDNVPIRSARFPSNWHLSTARAKSVADDM
LKAAPALQGKIRSEGRADSEGLVPNDTPEHRAINRRVDLLIQ
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3810025-3808637 Methylomonas methanica MC09 chromosome, complete genome
ATGAGTGAAAACGATCCCTTCGGACCTTTCGGCGACGATGACCGCACCGTCATACGGCCCATGCCGGGCG
GACGGCGCCCGGCTCCGGCTCCGGCTCAGACGCCTCCCGTGCAACCCGCGCAGCCCGCCCCCGCGTATGC
CGCGCCACCGCCGCCGCTAAATCCTGCACCCGCGCCCATGCCGGGATTCAATCCGTCCGCGCCGGTAGCC
TTGCCGACCACCGAATTTCAGCAAAACCCCATGGTGGCCGCTGCATTATCAATGATTTCATTGGCCAGCC
GTTTACGGCAAACCGCGGTTTATCCGGCGGTGGACGAACTGCGTCAGCGTTTGTCGGCCGAAGTCAGCGG
CTTCGAAAATAAATTATTGCAAACCGGCATCGGCGCCGATCAGGTGCGCATGGCCAGCTATGCGCTGTGC
AGTTTTCTGGATGAAACCATACTCAATACGCCCTGGGGCTCGCAGAGCAATTGGGGCCATCAAAGTTTGT
TGATTTCCTTTCACAAGGAAGCCTGGGGCGGCGAAAAATTTTTCGACATTATCGGCATGCTGGTCAAACA
ACCGGCTCAAAATCTGAATTTGATCGAACTGGCTTATTTATTTCTCAGTTTAGGTTTTCAGGGCAAGTTT
CGGATTTTGTCCAACGGCCTGAACGAACTGGAAAAATACCGGCTTGAGCTGTATCAGTTGATAGCGCGGG
TGAAGGGCGATTACGAACGTGAACTATCGCCGCGTTGGCAGGGTTTGCGCGACGTGCGTAATGCCTTGGT
GCGCTATGTGCCGTTGTGGGTGGTCGGCGCGGTATTGGGTGTGGCTTTGATTTTGACTTATATCGGCTTT
GTGCTGGCTTTGAATGCCCGCTCGGACCAGCTTTTCGCCGAATTATTCGGCTTGGGCAAGCAACCGATCG
AAATCGCCCAGGCCGCCGCCGTCATTCCGTTACCGGCACCGGTGCCGAAACCCGTGGTGCCGGAACGCCG
TGAACGCTTTAAGCAGTTACTGGCCAAGGAAATTGCCGCCGATATGGTCGAGGTCGTGGACGATAAATTA
TTACGCATACGTAATTCGTTTGCCTCCGGCAGCGACCAGCTCAAACCCCAGTTCGAACCCATGCTGAAAA
AAATCTCCGACGAACTGGTGGCGGGTAACGACCGGGTATTGGTCACGGGCCATACCGATAACGTGCCGAT
CCGCTCCGCGCGCTTTCCGTCAAATTGGCATTTATCCACTGCCAGGGCCAAATCGGTTGCCGACGATATG
TTGAAAGCAGCGCCGGCGCTGCAAGGCAAAATCCGCTCCGAAGGCCGGGCGGACAGCGAAGGCCTGGTGC
CTAACGATACTCCCGAACATCGCGCGATCAATCGCCGCGTCGATTTACTGATTCAGTGA
 Primer design