SecReT6
Protein ID: 333985102
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3444
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3810031..3811371 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDG0A719
KEGG IDmmt:Metme_3444
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-154, Aligned region: 19..444
Protein Sequence: 446 a.a.     [Download]
>gi|333985102|ref|YP_004514312.1| unnamed protein product [Methylomonas methanica MC09]
MSENNRIVWSEGMFLRPQHFQQHDRYFESLVRGLSQGVRTYLWGFSRLKLDRTCLAIGKLGLSECSGVFQ
DGTPFNLPQDDDLPLPLEVPEDEKASVVYLALPLRRSDAIEVDSESSPDNMARYHLGERQVRDHNSGADG
RYDVQIGSLKPRLMCDSQERSGYVCLGVARIVEVRADKTVILDEQYIPPAVHCSSAGILAGFARELQGLF
HTRGEALAARVAGGGQGGGVAEIADFMLLQMINRYQPLLAHLANAAAMHPEEFFQLCLQLAGELSTFYRP
GKRPMAFPDYKHDDLKFSFIPLIDELRGLLSMVLEQNAVQLPLAEVKPGVYVAKRPEINLLEGAIFVLAA
KAQVSSELIRSHFPPQVKIGPVEDIQTLVRSALPGITIQALPVAPRQIPYHAGYSYFELNKQSELWGKMS
ASGGFAIHIGGSFPELELEFWAIRKG
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3811371-3810031 Methylomonas methanica MC09 chromosome, complete genome
ATGTCAGAAAATAATCGGATAGTCTGGTCTGAGGGGATGTTTCTTCGCCCTCAGCATTTTCAACAGCATG
ATCGCTATTTTGAAAGCCTGGTGCGGGGCTTGTCCCAGGGGGTCAGAACGTATTTGTGGGGCTTTTCCCG
CCTCAAATTGGATAGGACCTGTCTGGCCATCGGAAAACTGGGGCTGAGCGAGTGCAGCGGGGTGTTTCAG
GACGGCACGCCGTTTAATCTGCCGCAGGACGACGATCTGCCGTTGCCGCTGGAAGTGCCGGAAGACGAAA
AAGCCAGCGTGGTTTACCTGGCCCTGCCGCTGCGGCGCTCGGACGCTATCGAAGTGGACAGCGAATCCTC
TCCGGATAATATGGCCCGTTATCATTTGGGCGAGCGGCAAGTGCGCGACCATAACAGCGGCGCGGACGGC
CGTTACGATGTGCAGATAGGCAGTTTAAAGCCGCGCTTGATGTGCGATAGCCAGGAACGTTCCGGCTATG
TCTGTTTGGGCGTGGCGCGTATCGTGGAAGTGCGGGCCGATAAAACCGTTATTTTGGATGAACAATACAT
TCCGCCGGCCGTGCATTGTTCCAGTGCCGGTATTCTGGCCGGCTTCGCCCGCGAGCTGCAAGGCTTGTTT
CATACTCGTGGAGAGGCTTTGGCGGCAAGGGTGGCCGGCGGCGGGCAGGGTGGCGGTGTGGCGGAGATAG
CCGATTTCATGTTGCTGCAAATGATCAACCGCTATCAACCCTTGCTGGCGCATTTGGCCAACGCCGCAGC
CATGCATCCAGAAGAATTCTTTCAATTATGTTTGCAACTTGCCGGCGAGTTGTCGACGTTTTACCGGCCC
GGTAAGCGGCCGATGGCGTTTCCCGATTACAAACACGACGATTTGAAGTTCAGCTTTATACCGCTGATCG
ATGAATTGCGCGGTTTGTTGAGCATGGTGTTGGAGCAAAACGCCGTACAATTGCCGCTGGCGGAAGTCAA
ACCCGGTGTTTACGTGGCCAAACGTCCGGAAATAAATTTGCTGGAAGGTGCCATTTTCGTTCTCGCGGCC
AAGGCGCAAGTCTCCTCGGAATTGATTCGCTCGCACTTCCCGCCGCAAGTCAAGATCGGCCCGGTGGAAG
ATATCCAGACATTGGTTCGTTCGGCATTGCCCGGCATCACCATTCAGGCCCTGCCGGTGGCGCCGCGGCA
GATTCCCTATCATGCCGGTTATTCCTATTTCGAATTGAATAAGCAAAGCGAGCTGTGGGGCAAAATGTCC
GCCTCCGGCGGTTTCGCCATTCATATTGGCGGGAGTTTTCCGGAATTGGAGCTCGAGTTTTGGGCCATTA
GAAAAGGTTGA
 Primer design