SecReT6
Protein ID: 333985103
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3445
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3811407..3812900 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG0A720
KEGG IDmmt:Metme_3445
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.80E-14, Aligned region: 29..96
Protein Sequence: 497 a.a.     [Download]
>gi|333985103|ref|YP_004514313.1| unnamed protein product [Methylomonas methanica MC09]
MVLILKVLTYKGVPSSQPISAQFEGQGGSIGRAPNNQLVLPDPEKFISRVHASIVCEAGHYFIEDSSTGG
TFLNDSDIPLQQSRAPLSDGEKIRIGEYELLATIADSATAGFAASIEQPVRQLDFAQNSVLDGPFVPAQP
AASQPKADFFSSFVEQPESSAFHQSFTPPQIAETPGNAAVDDLDFGDLLSKLDELPGISHPASSKPAADL
PPLPADFFAEETPKPAEASPFPSAVESETSWPPFDEAPAEAPQVPPFAVSEAEPPAPQQQAVEPVFPGEP
AKRYEIVEPPMPAAQPVQPQTHNAAADDVLFREFLAGAGISDLHLLPPEQWPALMRTSGELLRAMVQGLM
QVLRARAELKSQFRVSVTTMRSVDNNPLKFTPSVDDAMKLILAPTNPGFLPPKQAVSEGFNDIMNHQIAM
TAGIQAALAEILRSFDPQLIERTQAEGVLFQKKTKCWEYYVEKYPQLKAVAQEEFFGDAFADAYEKQMLL
LSRAAKN
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3812900-3811407 Methylomonas methanica MC09 chromosome, complete genome
ATGGTGTTGATTCTCAAGGTCCTAACTTATAAAGGCGTACCTTCCAGTCAGCCCATTAGCGCTCAGTTCG
AAGGTCAAGGCGGCTCGATTGGCCGGGCGCCAAATAATCAACTGGTTTTACCCGATCCGGAAAAATTTAT
TTCGCGGGTGCATGCCAGCATCGTATGCGAAGCCGGACATTATTTTATTGAAGATAGTAGTACCGGCGGC
ACTTTTCTCAACGATAGCGATATCCCGTTGCAGCAAAGCCGGGCGCCGTTATCGGACGGCGAAAAAATCC
GCATAGGCGAATACGAGCTTCTGGCCACTATTGCCGATTCGGCTACGGCCGGTTTTGCCGCCAGCATAGA
ACAACCGGTAAGGCAGTTGGATTTTGCCCAGAACAGCGTACTGGACGGTCCGTTCGTGCCGGCTCAGCCC
GCGGCTTCCCAGCCCAAGGCGGATTTTTTTTCCAGCTTTGTTGAACAGCCGGAATCTTCGGCTTTCCATC
AAAGTTTTACCCCGCCGCAAATCGCCGAAACACCGGGTAACGCAGCGGTAGACGATCTGGACTTCGGCGA
TTTGTTATCTAAATTGGATGAATTGCCGGGTATCAGTCATCCCGCCAGTAGTAAGCCGGCCGCCGATCTG
CCGCCCTTGCCGGCGGACTTTTTTGCCGAAGAAACGCCTAAGCCGGCAGAGGCAAGCCCTTTCCCGTCCG
CGGTGGAGTCCGAAACGTCTTGGCCGCCATTCGATGAAGCGCCGGCGGAAGCGCCGCAAGTTCCCCCATT
CGCTGTGTCGGAAGCTGAGCCGCCGGCACCTCAACAGCAGGCGGTCGAGCCTGTTTTCCCCGGAGAACCC
GCGAAACGATATGAAATTGTCGAGCCGCCAATGCCGGCTGCGCAGCCTGTTCAGCCTCAGACGCATAATG
CTGCAGCGGATGACGTGTTATTCCGCGAATTTTTAGCCGGGGCCGGCATTAGCGATCTGCATTTGCTGCC
GCCAGAACAATGGCCGGCCCTGATGAGAACGTCCGGCGAACTTTTGCGTGCCATGGTGCAGGGTTTGATG
CAGGTATTAAGAGCAAGGGCGGAATTGAAAAGCCAGTTTCGCGTCTCGGTGACCACCATGCGTTCGGTCG
ATAACAATCCGCTAAAATTTACGCCGAGCGTGGACGATGCCATGAAACTGATCCTGGCACCCACCAACCC
CGGGTTTTTGCCGCCCAAGCAAGCTGTCAGTGAAGGATTTAACGACATCATGAACCATCAGATTGCCATG
ACCGCCGGTATACAGGCGGCGTTGGCGGAAATACTGCGCAGTTTCGATCCGCAACTGATTGAAAGGACGC
AAGCCGAGGGTGTTTTGTTTCAGAAAAAGACCAAGTGCTGGGAATATTATGTTGAAAAATATCCGCAGCT
CAAAGCGGTCGCGCAGGAAGAGTTTTTTGGCGACGCGTTTGCCGATGCCTATGAAAAACAAATGCTGTTA
CTAAGCCGGGCAGCGAAAAATTAA
 Primer design