SecReT6
Protein ID: 333985106
SecReT6 ID444
T6SS typeN/A
Gene symbol-
Locus tagMetme_3448
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T6SS(s) in this replicon]
Location [Strand]3816088..3816561 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDG0A723
KEGG IDmmt:Metme_3448
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.90E-41, Aligned region: 12..150
Protein Sequence: 157 a.a.     [Download]
>gi|333985106|ref|YP_004514316.1| unnamed protein product [Methylomonas methanica MC09]
MKRYISLVLLNAVLLGCASEPPVQPPPPPPTIVNLQIETSADLNADINGNGAPLMLRIYELREQSNFNSA
DFFAIFNNEKATLAADLVRKQELLLQPGETKSLSLNPDNDVQSIGFFAGFRQLDTAQWRAVASVKEHQTQ
SVQIKLKNNQLTVEVPN
 
Nucleotide Sequence: 474 bp     [Download]
>gi|333981747|ref|NC_015572.1|:c3816561-3816088 Methylomonas methanica MC09 chromosome, complete genome
ATGAAACGATATATATCTCTGGTTTTGCTGAATGCCGTGTTGCTGGGTTGCGCCAGCGAACCGCCGGTTC
AGCCCCCGCCCCCGCCGCCGACTATCGTGAACTTGCAAATAGAAACGTCTGCCGATCTGAATGCCGATAT
TAATGGTAACGGCGCGCCGCTTATGTTACGGATATACGAATTGCGCGAACAAAGCAATTTCAATTCCGCC
GATTTTTTTGCGATCTTCAACAATGAAAAAGCCACGCTGGCGGCTGATTTAGTGCGTAAACAAGAGCTGC
TGTTACAACCCGGCGAAACCAAAAGCCTGAGCCTGAATCCGGATAACGATGTGCAATCCATCGGTTTTTT
TGCCGGTTTCCGGCAACTGGACACCGCGCAATGGCGAGCCGTGGCAAGTGTCAAAGAGCACCAAACCCAA
TCGGTGCAAATCAAATTGAAAAATAACCAATTAACGGTGGAAGTTCCGAATTGA
 Primer design