SecReT6
Protein ID: 33595425
SecReT6 ID10
T6SS typei3
Gene symbol-
Locus tagBPP0730
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T6SS(s) in this replicon]
Location [Strand]771707..775312 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ7W1F9
KEGG IDbpa:BPP0730
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 72..112
ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 206..470
IcmF-related [PF06761], Evalue: 6.50E-90, Aligned region: 519..829
DUF1215 [PF06744], Evalue: 4.10E-33, Aligned region: 875..889
DUF1215 [PF06744], Evalue: 4.10E-33, Aligned region: 938..1062
Protein Sequence: 1201 a.a.     [Download]
>gi|33595425|ref|NP_883068.1| unnamed protein product [Bordetella parapertussis 12822]
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIAALFAFALLRLLWRKWRE
GRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLP
WYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGD
EESWRGFLGLLTRFRGRQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTK
ADLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEAR
RALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWLASYGNNVRYL
DEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGV
YRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYT
RRQYDLMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLG
GPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIV
DIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVN
ELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATI
GLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMIDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQAS
ALLDSFQRAAAIRDAYFMAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRG
ANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLA
EMRGFSCPGRS
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|33594723|ref|NC_002928.3|:771707-775312 Bordetella parapertussis 12822 chromosome, complete genome
ATGATCCCGCGCCTGTTCGGATGGCTGTTCTCGCGCGGCCTGTGGAGCTTCCTGGGCCTGGTGGCGCTGG
CCCTGCTGGTGTGGATCGCCGGGCCGCTGCTGGCGATCGGCGCGCTGCGCCCGCTGGAAAGCGAGACCGC
GCGCGTACTGGTCATCGCCGCGCTGTTCGCCTTCGCGCTGCTGCGCCTGCTGTGGCGCAAGTGGCGCGAA
GGCCGCCTCAACGCCCAGTTGCTGGGCCAGCTGCGCCGGCCGGCCCGTCCCGAGGCCGAGGCCGCGGCCG
AGCCGCCGCCTTCGGACCTGCGCGAACTGGAAGGCCGCTTCGACGAGGCGGTGGAGCTGTTGCGCAAGAC
GCGCTTCGACGGAGGCGGCGGACGCGGCTGGCTGCAGCGCTATTCGCGCCAATACCTGTACCAGCTGCCC
TGGTACGTCATCATCGGCGCGCCAGGCTCGGGCAAGACCACGGCCCTGGTCAACTCGGGCCTGGACTTCC
CGCTGGCCGAGCGCTTCGGCAAGGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGATTGGTGGTT
CACCGACGACGCGGTGCTGCTCGATACCGCCGGCCGCTACACCACCCATGAAAGCGACCCCACCGGCGAC
GAGGAGTCCTGGCGCGGCTTTCTCGGCCTGTTGACGCGCTTTCGGGGCCGCCAGCCCATCAACGGCGCCA
TGCTCACCGTCAGCATCGAGGACTTGCTGGCCGCGTCCGACGCCGAGCGCGCGCGCCACGCCGCGGTGCT
GCGCCGGCGCCTGCAGGAGCTGCGCGAGCAGCTGGGCATCCATTTCCCGGTCTATGTGCTGGTGACCAAG
GCCGACCTGCTGGCCGGCTTCGAGCAGTACTTCGCCTCGTTCAGCCGCGAAGACCTGGAGCAGGTATGGG
GCTTCACCTTGCCCTATGCGCGCGCCCAGGAGCCGGACTTCGACCTGTACGAAGCCTTTCATGCCGAGTA
CCGGCTGCTGCAGCGCCGGCTCGACGATGCCCTGCCCGAAGTGCTGGCCGCCGAGCCGGACGAGGCGCGC
CGCGCGCTGGCCTACCTGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCGTGCTGGGCCATTTCCTCAGCG
ACGTGTTCGCCAGCTCGCGCTTCGAGGAGCGCCTGGTGCCGCGCGGCGTGTACTTCACCAGCGGCACCCA
GGGCGGCGAGACCTTCGACCAGGTCACCGGCCACCTCAAGCGCTATCTGCGCATCGAAAGCGGGCCGGCC
CCGGCCGCCGCCGAGGAAGGCCGCAGCTTCTTCCTCAAGCGGCTGCTGCAGGACGTGATCTTTCCCGAGG
CCGGCCTGGCCGGCCGCAACCTGCGCTGGGAGCGCCGCTACCGCCGCCTGCACTGGGCCGGCTACGGCCT
GATCACGCTGGCGTTCCTGGGCCTGGCGGCGGGCTGGCTGGCCAGCTACGGCAACAACGTGCGCTATCTC
GACGAAGTGGCGCGCCGCGTGCCGACGGTGGACAAGCTGGGGCGCGATATCAAGATCACCCGCTCGGGCG
ATGTGCTGGGCCTGATGCCCTTCCTGGACGGCCTGTGGTACCTGCCGCGCGACGCCGCCTTCGAGCCGGA
CGCGCCGCCGCTGTCCTATCGCTTCGGGCTGTACCAGGGCGGCAAGATGCACGCCGCGATGCAGGGCGTT
TATCGCGGCACGCTCGACAGCGTCCTGCTGCCGCAGGTGGCGCGCCGCATCGAGGCGGCGCTGCGCGCGG
CCCGCGCCGACGACCTGGAGTACGGCTACGAGGCCCTGCGCGCCTACCTGATGCTGTACGAGGCCGACCA
CTACGACGCCGAGTTCATGCACGCCTGGCTGCTGTCCGACATGCAGGGCACGCTGCCCGAGGGCTACACG
CGCCGGCAGTACGACCTGATGTCGCTGCACCTGCGCCAGCTGGCGCAGGGCGGCGTGCTGGCCTCGCCGT
TTCCGCGCGACGAGGCGCTGGTGCGGCAGGCGCGCGACGAACTGGCGCGCCACACGCTGGCGCAGCGCGC
CTACAGCCGGCTGCGCCGCATGCTGGCCGGCGCCGACGATCAGCCGCCGACCACCGCGGTGACGCTGGGC
GGGCCGCAGGCCAGCGCCGTCTTCGTGCGCAAGAGCGGCAAGCCGCTGGCCCAGGGCATCGCGGCGCTGT
ACACCTACCGCGGCTATTGGGACGTGTTCAATCCGCGCGTCACGCGCGTGGCCGAGCGCCTGCGCAGCGA
CGATGCCTGGGTCCTGGACATCGCGCCGCCGGGCGTGCTGGACGAGGCTGCGCGCCAGCAGCTCATCGTC
GACATCAAGCGCCTGTACCTCAACGACTACGTGGCGCGCTGGGACGGCTACCTGGACGACCTGGCGCTGG
CGCCGCGCAGCTCGCTGCTGCAAAGCATCCAGCTGGCGCGCACCCTGTCGGCGCCCGATTCGCCGCTGGT
GCGGCTGACCCAGGGCGTGGCGCGCGAGACCACGCTGCTGCGCGACGCGGGCGGCGACGAGCGCTCGCTG
GCGGACCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGTTCGGCCCGACCGGCC
CGGGTGCGGCCACGCGCGCCGACGCCGGCGACGGCAAGCTGGAGCGCGTGGTCGACCAGCACTTCGAGCC
ATGGCGCAGGCTGGCGCGCGCCGACGGGCAGGGCGGCGCGCCGATTGCCGCCACCACCAGCCTGGTCAAC
GAGCTGTACACCTATCTGACGGCGGCCGACGCGGCTCTGCGCAGCGCCAGCCCGGCGCCCGCCTCCGATG
TGGTGACCAAGCTGCGCGCCGAGGCTGGCCGCCTGCCGCGGCCCTTGCGCGACGTGCTCGACGACTTGTC
CACCGGCGCGGCGGGCGAAGTGTCCGGCGTGGCGCGCGAGCGGCTGGGCGAAGACCTGTACGCCACCATC
GGCCTGTTCTGCCGCCAGGCCATCGCCGGCCGCTATCCTTTCGCGCCCGGCTCGCCGCGCGACGTCGCGC
CCAATGACCTGGCGCGGCTGTTCGCGCCCAACGGCATGATAGACGAGTTCTTCCAGAAGAACCTGGTCAG
CCAGATCGATGTGTCCGAGGCGCGCTGGCGCTTCAAGCCGGGCATGGACGGCACGCCGGGCCAGGCGTCG
GCGCTGCTGGATTCGTTCCAGCGCGCCGCCGCGATCCGCGACGCCTATTTCATGGCCGGCAGCGCGGAGC
CGGCCTTTCGCGTCTCGATCCGTCCGGTGGAAATGGACCCGGCCATCACGCAATTCGTCATGGACGTGGA
CGGCCAGACCGTGCGCTATGCGCATGGCCCGCAGGTCGCCACCTCCGTGCAATGGCCGGGGCCGCGCGGC
GCCAACCAGGTGCGCATCGAGCTGACGCCCCAGGCCGGCGCGGCGGGCCTGTCGGCCAGCGGACCGTGGG
CACTCAATCGCCTGCTCGACCAGGCCCGCGTCACGCGCGGCGCCTCGCCCGAGATCTCGCTGGCCAGCTT
CGATATCGGCGGCCGCAAAGTGGTGCTGGAGATCCGCGCGGGCAGCGTCAGGAGCCCCTTTCACCTGGCC
GAGATGCGGGGTTTTTCCTGCCCGGGCCGTTCATGA
 Primer design