SecReT6
Protein ID: 33599805
SecReT6 ID9
T6SS typei3
Gene symbol-
Locus tagBB0816
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T6SS(s) in this replicon]
Location [Strand]856646..860251 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ7WP69
KEGG IDbbr:BB0816
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 72..112
ImcF-related_N [PF14331], Evalue: 1.90E-99, Aligned region: 206..470
IcmF-related [PF06761], Evalue: 6.50E-90, Aligned region: 519..829
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 875..889
DUF1215 [PF06744], Evalue: 2.30E-33, Aligned region: 938..1062
Protein Sequence: 1201 a.a.     [Download]
>gi|33599805|ref|NP_887365.1| unnamed protein product [Bordetella bronchiseptica RB50]
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIAALFAFALLRLLWRKWRE
GRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLP
WYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGD
EESWRGFLGLLTRFRGRQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTK
ADLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEAR
RALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWLASYGNNVRYL
DEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGV
YRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYT
RRQYDLMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLG
GPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIV
DIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVN
ELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATI
GLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQAS
ALLDSFQRAAAIRDAYFMAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRG
ANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLA
EMRGFSCPGRS
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|33598993|ref|NC_002927.3|:856646-860251 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGATCCCGCGCCTGTTCGGATGGCTGTTCTCGCGCGGCCTGTGGAGCTTCCTGGGCCTGGTGGCGCTGG
CCCTGCTGGTGTGGATCGCCGGGCCGCTGCTGGCGATCGGCGCGCTGCGCCCGCTGGAAAGCGAGACCGC
GCGCGTACTGGTCATCGCCGCGCTGTTCGCCTTCGCGCTGCTGCGCCTGCTGTGGCGCAAGTGGCGCGAA
GGCCGCCTCAACGCCCAGCTGCTGGGCCAGCTGCGCCGGCCGGCCCGTCCCGAGGCCGAGGCCGCGGCCG
AGCCGCCGCCTTCGGACCTGCGCGAACTGGAAGGCCGTTTCGACGAGGCGGTGGAGCTGTTGCGCAAGAC
GCGCTTCGACGGAGGCGGCGGGCGCGGCTGGCTGCAGCGCTATTCGCGCCAATACCTGTACCAGCTGCCC
TGGTACGTCATCATCGGCGCGCCAGGCTCGGGCAAGACCACGGCCCTGGTCAACTCGGGCCTGGACTTCC
CGCTGGCCGAGCGCTTCGGCAAGGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGATTGGTGGTT
CACCGACGACGCGGTGCTGCTCGATACCGCCGGCCGCTACACCACCCATGAAAGCGACCCCACCGGCGAC
GAGGAGTCCTGGCGCGGCTTTCTCGGCCTGTTGACGCGCTTTCGGGGCCGCCAGCCCATCAACGGCGCCA
TGCTCACCGTCAGCATCGAGGACTTGCTGGCCGCGTCCGACGCCGAGCGCGCGCGCCACGCCGCGGTGCT
GCGCCGGCGCCTGCAGGAGCTGCGCGAGCAGCTGGGCATCCATTTCCCGGTCTATGTGCTGGTGACCAAG
GCCGACCTGCTGGCCGGCTTCGAGCAGTACTTCGCCTCGTTCAGCCGCGAAGACCTGGAGCAGGTATGGG
GCTTCACCTTGCCCTATGCGCGCGCCCAGGAGCCGGACTTCGACCTGTACGAAGCCTTTCATGCCGAGTA
CCGGCTGCTGCAGCGCCGGCTCGACGATGCCCTGCCCGAAGTGCTGGCCGCCGAGCCGGACGAGGCGCGC
CGCGCGCTGGCCTACCTGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCGTGCTGGGCCATTTCCTCAGCG
ACGTGTTCGCCAGCTCGCGCTTCGAGGAGCGCCTGGTGCCGCGCGGCGTGTACTTCACCAGCGGCACCCA
GGGCGGCGAGACCTTCGACCAGGTCACCGGCCACCTCAAGCGCTATCTGCGCATCGAAAGCGGGCCGGCC
CCGGCCGCCGCCGAGGAAGGCCGCAGCTTCTTCCTCAAGCGGCTGCTGCAGGACGTGATCTTTCCCGAGG
CCGGCCTGGCCGGCCGCAACCTGCGCTGGGAGCGCCGCTACCGCCGCCTGCACTGGGCCGGCTACGGCCT
GATCACGCTGGCGTTCCTGGGCCTGGCGGCGGGCTGGCTGGCCAGCTACGGCAACAACGTGCGCTATCTC
GACGAAGTGGCGCGCCGCGTGCCGACGGTGGACAAGCTGGGGCGCGATATCAAGATCACCCGCTCGGGCG
ATGTGCTGGGCCTGATGCCCTTCCTGGACGGCCTGTGGTACCTGCCGCGCGACGCCGCCTTCGAGCCGGA
CGCGCCGCCGCTGTCCTATCGCTTCGGGCTGTACCAGGGCGGCAAGATGCACGCCGCGATGCAGGGCGTT
TATCGCGGCACGCTCGACAGCGTCCTGCTGCCGCAGGTGGCGCGCCGCATCGAGGCGGCGCTGCGCGCGG
CCCGCGCCGACGACCTGGAGTACGGCTACGAGGCCCTGCGCGCCTACCTGATGCTGTACGAGGCCGACCA
CTACGACGCCGAGTTCATGCACGCCTGGCTGCTGTCCGACATGCAGGGCACGCTGCCCGAGGGCTACACG
CGCCGGCAGTACGACCTGATGTCGCTGCACCTGCGCCAGCTGGCGCAGGGCGGCGTGCTGGCCTCGCCGT
TTCCGCGCGACGAGGCGCTGGTGCGGCAGGCGCGCGACGAACTGGCGCGCCACACGCTGGCGCAGCGCGC
CTACAGCCGGCTGCGCCGCATGCTGGCCGGCGCCGACGATCAGCCGCCGACCACCGCGGTGACGCTGGGC
GGGCCGCAGGCCAGCGCCGTCTTCGTGCGCAAGAGCGGCAAGCCGCTGGCCCAGGGCATCGCGGCGCTGT
ACACCTACCGCGGCTATTGGGACGTGTTCAATCCGCGCGTCACGCGCGTGGCCGAGCGCCTGCGCAGCGA
CGATGCCTGGGTCCTGGACATCGCGCCGCCGGGCGTGCTGGACGAGGCTGCGCGCCAGCAGCTCATCGTC
GACATCAAGCGCCTGTACCTCAACGACTACGTGGCGCGCTGGGACGGCTACCTGGACGACCTGGCGCTGG
CGCCGCGCAGCTCGCTGCTGCAAAGCATCCAGCTGGCGCGCACCCTGTCGGCGCCCGATTCGCCGCTGGT
GCGGCTGACCCAGGGCGTGGCGCGCGAGACCACGCTGCTGCGCGACGCGGGCGGCGACGAGCGCTCGCTG
GCGGACCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGTTCGGCCCGACCGGCC
CGGGCGCGGCCACGCGCGCCGACGCCGGCGACGGCAAGCTGGAGCGCGTGGTCGACCAGCACTTCGAGCC
ATGGCGCAGGCTGGCGCGCGCCGACGGGCAGGGCGGCGCGCCGATTGCCGCCACCACCAGCCTGGTCAAC
GAGCTGTACACCTATCTGACGGCGGCCGACGCGGCTCTGCGCAGCGCCAGCCCGGCGCCCGCCTCCGATG
TGGTGACCAAGCTGCGCGCCGAGGCTGGCCGCCTGCCGCGGCCCTTGCGCGACGTGCTCGACGACTTGTC
CACCGGCGCGGCGGGCGAAGTGTCCGGCGTGGCGCGCGAGCGGCTGGGCGAAGACCTGTACGCCACCATC
GGCCTGTTCTGCCGCCAGGCCATCGCCGGCCGCTATCCTTTCGCGCCCGGCTCGCCGCGCGACGTCGCGC
CCAATGACCTGGCGCGGCTGTTCGCGCCCAACGGCATGATGGACGAGTTCTTCCAGAAGAACCTGGTCAG
CCAGATCGATGTGTCCGAGGCGCGCTGGCGCTTCAAGCCGGGCATGGACGGCACGCCGGGCCAGGCGTCG
GCGCTGCTGGATTCGTTCCAGCGCGCCGCCGCGATCCGCGACGCCTATTTCATGGCCGGCAGCGCGGAGC
CGGCCTTTCGCGTCTCGATCCGTCCGGTGGAAATGGACCCGGCCATCACGCAATTCGTCATGGACGTGGA
CGGCCAGACCGTGCGCTATGCGCATGGCCCGCAGGTCGCCACTTCCGTGCAATGGCCGGGGCCGCGCGGC
GCCAACCAGGTGCGCATCGAGCTGACGCCCCAGGCCGGCGCGGCGGGCCTGTCGGCCAGCGGACCGTGGG
CACTCAATCGCCTGCTCGACCAGGCCCGCGTCACGCGCGGCGCCTCGCCCGAGATCTCGCTGGCCAGCTT
CGATATCGGCGGCCGCAAAGTGGTGCTGGAGATCCGCGCGGGCAGCGTCAGGAGCCCCTTTCACCTGGCC
GAGATGCGGGGTTTTTCCTGCCCGGGCCGTTCATGA
 Primer design