SecReT6
Protein ID: 336124006
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03044
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1524619..1524915 [-]
Producthypothetical protein
NotePAAR
UniProt IDF7YHX9
KEGG IDvan:VAA_03044
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.00E-20, Aligned region: 2..19
PAAR_motif [PF05488], Evalue: 6.00E-20, Aligned region: 23..90
DUF4150 [PF13665], Evalue: 0.00041, Aligned region: 7..47
DUF4150 [PF13665], Evalue: 0.00041, Aligned region: 38..89
Protein Sequence: 98 a.a.     [Download]
>gi|336124006|ref|YP_004566054.1| hypothetical protein VAA_03044 [Vibrio anguillarum 775]
MLPAARATDMHMCPMQTPAVVPIPHVGGPLLPLPTTVLIGNLPAATLGQICVCVGPPDSIVKGSATVLIN
NKPSARMGDLTAHGGTIVMGMPTVLIGG
 
Nucleotide Sequence: 297 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c1524915-1524619 Vibrio anguillarum 775 chromosome I, complete sequence
ATGCTTCCAGCAGCCAGAGCAACAGACATGCACATGTGCCCGATGCAAACACCAGCAGTGGTGCCAATCC
CTCACGTAGGCGGGCCATTACTCCCTCTGCCAACAACAGTATTAATCGGCAACCTACCAGCTGCCACTCT
AGGACAGATATGTGTTTGTGTCGGCCCTCCAGATAGCATAGTTAAAGGAAGTGCAACCGTGCTGATTAAC
AATAAACCCTCAGCGCGCATGGGCGACCTAACTGCCCACGGTGGGACTATCGTGATGGGGATGCCAACTG
TCTTGATTGGAGGGTAA
 Primer design