SecReT6
Protein ID: 336124008
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03042
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1525488..1527485 [-]
ProductVgrG
NoteTssI
UniProt IDF7YHY1
KEGG IDvan:VAA_03042
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-46, Aligned region: 34..330
Phage_base_V [PF04717], Evalue: 7.60E-22, Aligned region: 367..457
DUF2345 [PF10106], Evalue: 0.00067, Aligned region: 207..235
DUF2345 [PF10106], Evalue: 0.00067, Aligned region: 520..644
Protein Sequence: 665 a.a.     [Download]
>gi|336124008|ref|YP_004566056.1| VgrG [Vibrio anguillarum 775]
MNMSSNELKHQTRSLTIKLSDSKSYIVTQLIGEESVSGGCQFSVSIAANMEIDTKNLGKAVCVSYELDSG
KRFFSGICSTLQFTGYSKDKQQFYYQIEILDPLSLLQYKRSRQIFQNVTTKKIIEKLLEQADLKSYFHFS
LSGSGKNHEYCVQLDETDQAFIQRLLANEGWHYHVRHQCNKSTVCIGDSNQRFEKIPDPKLSYQIGGNNQ
QHVLTTWSQAHHVGSGKVSVADHTQNLAEFFDSGPRKSTESYAPTSLTQELFAFGHENKNEVRDAAKMHM
EALDLRKSASHSSSNLATLACGYKFELTYHPLSSMNQEYIITHLSHRLSREESNNEVAYQNQFSCIPSSL
IFRPEIFDKPRVHSLHTATVTGPKGEEIYRDKWGRVKVQFHWDRGGKNDENSSCWLPVSQGFASKGFGSQ
FTPRIGDEVIVQYIDGDPNRPIVTGSLYNKNSAAPYSSDTQNGIKTRSTPKGSSKQGNELRFEDQKDKEQ
VYLHAEKDLLLDVNNDSQSTIKGIKKTQVEKSATLSVKEHIQVESDKTLTAKSKDNWTGDSEKDLSLNAA
SNINIAAKSTVSVDGNQVSICGKSKIELKVGTSKIEISASGIKIDAPQVSVSGKAKAEVKAAMINIEGQG
KVDVKAALVSVNGSSMTQIKAGAMVQIQGAITKVN
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c1527485-1525488 Vibrio anguillarum 775 chromosome I, complete sequence
TTGAATATGAGCAGTAACGAATTAAAGCACCAAACCCGCTCCCTCACCATTAAGCTTTCAGATAGCAAAA
GTTATATTGTCACGCAATTAATCGGAGAGGAAAGCGTATCCGGCGGGTGTCAGTTTTCCGTTTCCATCGC
GGCAAACATGGAGATCGATACCAAAAACCTAGGTAAAGCTGTTTGTGTGTCTTACGAATTAGATTCTGGA
AAACGTTTTTTTTCAGGTATATGTAGCACTCTGCAATTCACAGGATATAGCAAAGACAAGCAGCAGTTTT
ATTATCAAATAGAGATATTGGATCCACTTAGCTTGTTGCAATACAAACGCAGTCGTCAGATTTTTCAAAA
CGTAACGACGAAAAAGATCATTGAAAAGCTGCTAGAACAGGCTGATCTCAAAAGCTATTTTCACTTTTCC
CTTTCCGGAAGTGGGAAAAATCATGAGTATTGTGTTCAACTTGATGAAACCGACCAAGCTTTTATACAAC
GCTTGTTAGCAAACGAAGGATGGCACTACCATGTACGCCATCAATGCAATAAGTCGACAGTCTGCATTGG
CGATTCAAATCAACGATTTGAGAAAATACCGGATCCAAAGTTAAGTTATCAAATAGGTGGCAACAATCAG
CAGCACGTACTAACCACGTGGAGTCAAGCCCACCATGTTGGCAGTGGAAAGGTATCTGTCGCCGATCATA
CTCAAAACCTGGCTGAATTTTTTGATAGCGGCCCCCGAAAAAGCACCGAAAGTTACGCGCCGACTTCATT
GACACAAGAACTCTTTGCATTTGGTCACGAGAATAAAAATGAAGTCCGTGACGCAGCAAAAATGCATATG
GAAGCGTTAGATCTTAGGAAGTCAGCCTCTCACTCATCATCAAATTTAGCGACGCTTGCTTGCGGCTATA
AATTTGAACTAACGTACCATCCTCTCAGTTCAATGAACCAAGAGTACATCATCACTCATCTATCACATCG
CCTATCCAGAGAAGAATCGAACAACGAAGTCGCTTATCAGAACCAGTTTTCTTGTATCCCTTCGTCACTG
ATTTTCCGTCCAGAAATATTTGACAAACCGCGTGTCCATAGCTTACATACCGCAACCGTCACCGGGCCTA
AGGGAGAAGAGATTTACCGAGATAAATGGGGTCGAGTAAAAGTGCAATTTCACTGGGATAGAGGCGGAAA
AAATGACGAAAACAGTTCATGTTGGTTGCCAGTATCGCAAGGGTTCGCCAGTAAGGGGTTCGGTTCTCAA
TTCACACCGCGCATTGGTGATGAAGTGATTGTGCAATACATTGATGGCGACCCCAATCGCCCTATCGTGA
CCGGCTCTTTATACAACAAAAACAGCGCAGCCCCTTACAGCTCGGATACTCAAAATGGCATCAAAACTCG
TTCAACGCCTAAGGGCAGTAGCAAGCAAGGAAACGAACTGCGGTTTGAAGATCAAAAAGACAAAGAACAA
GTGTATTTACATGCTGAAAAAGATTTGCTACTTGACGTAAATAACGACAGCCAGTCAACGATTAAAGGCA
TTAAAAAGACCCAAGTTGAGAAGAGTGCCACCTTAAGCGTTAAAGAACACATACAAGTCGAAAGTGATAA
AACACTTACCGCCAAAAGTAAAGATAACTGGACGGGTGACAGTGAGAAAGATCTAAGCCTCAATGCCGCT
TCCAACATCAATATTGCGGCTAAATCGACGGTCAGCGTTGATGGCAACCAAGTGTCGATCTGCGGTAAAT
CGAAGATCGAACTCAAAGTGGGCACGAGCAAAATCGAGATCAGCGCTAGTGGTATTAAGATCGACGCTCC
TCAAGTCTCTGTTTCAGGTAAAGCAAAAGCAGAGGTGAAAGCCGCAATGATCAATATTGAAGGCCAAGGG
AAGGTCGATGTAAAAGCAGCGTTAGTGTCGGTTAACGGCAGCTCCATGACACAAATAAAAGCCGGGGCCA
TGGTGCAAATTCAAGGCGCAATTACAAAGGTAAATTGA
 Primer design