SecReT6
Protein ID: 336124010
SecReT6 ID445
T6SS typei5
Gene symbol-
Locus tagVAA_03040
StrainVibrio anguillarum 775
Repliconchromosome I [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]1528113..1529546 [+]
Producthypothetical protein
NoteTssA
UniProt IDF7YHY3
KEGG IDvan:VAA_03040
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-08, Aligned region: 83..143
Protein Sequence: 477 a.a.     [Download]
>gi|336124010|ref|YP_004566058.1| hypothetical protein VAA_03040 [Vibrio anguillarum 775]
MTLKQIVNLTEQEPMPLSKHQIEQLSKPLSDDSICGVYLKLEKSAFRPLRNEFNVAQTALRKLSQNPSAD
ERDALQEACLNKWKILSDSLYEQFSKTTRDIELISWFVAAQFLLDTTLESAANSLEWLADLSEKHWDHLN
PVLPVETLKSDDDKGKEREQADAKVKAFFQLVGDSEESSILYAPVLQLPLVGEVTFFDFQSAERKGEISQ
LKSMLTTTVAQERFAIQFKMENAKRCVTQLDRLSALVSTKCHSLGSQSTNFGFAKSLLTRVENALVHLSG
IKLAPKAEAKTVEQEVAESSVSEGELPSHMDTKHIERIPMASEQAQTVSQHLHAGNLSELGNLNNMNRDL
AFHLLREVSDYFRQSEPHSPISFLLEKAIRWGYLSLPELLREMMSEQNGDALSTIFNAAGLNHLDQVLLP
EVSTPTVGIESPQTPQAKPSVSDPRSVEEHVSQTSPVDTQSKQDQKPQSSATSALSW
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|336122587|ref|NC_015633.1|:1528113-1529546 Vibrio anguillarum 775 chromosome I, complete sequence
TTGACACTTAAGCAAATAGTCAACCTAACAGAGCAGGAACCTATGCCTTTGTCAAAGCATCAAATTGAGC
AACTTTCTAAACCTCTGAGTGATGATTCGATCTGTGGCGTTTATCTTAAACTGGAAAAAAGTGCTTTTCG
CCCATTACGTAATGAATTTAATGTCGCGCAAACTGCGCTGCGTAAGCTAAGTCAAAACCCTAGTGCTGAC
GAGAGAGATGCGTTACAAGAGGCATGTCTAAATAAGTGGAAGATTCTCTCTGACAGTTTGTACGAACAGT
TTTCAAAAACAACCAGAGATATCGAGCTCATCTCATGGTTTGTTGCTGCTCAATTCCTTCTCGATACCAC
ATTAGAAAGTGCTGCGAATAGCCTTGAGTGGTTAGCGGATTTAAGTGAGAAGCACTGGGATCACCTCAAC
CCTGTACTACCAGTTGAAACGCTCAAATCTGATGATGATAAGGGCAAAGAAAGAGAGCAAGCAGATGCGA
AAGTTAAAGCATTTTTCCAACTAGTCGGCGATAGCGAGGAAAGCTCGATTCTCTATGCGCCGGTGCTGCA
ACTGCCCTTAGTCGGGGAAGTGACGTTTTTTGACTTTCAAAGTGCAGAGAGAAAAGGCGAAATCAGCCAA
CTGAAATCTATGCTTACGACCACGGTGGCGCAAGAGCGTTTCGCGATTCAATTCAAGATGGAAAACGCCA
AACGTTGTGTCACCCAATTAGATCGTTTGTCAGCGTTGGTGAGCACTAAGTGTCATTCTCTAGGCAGTCA
AAGTACCAACTTCGGATTTGCGAAGTCACTGCTTACCCGTGTTGAAAACGCTTTGGTTCATCTAAGTGGA
ATTAAGTTAGCACCGAAAGCGGAGGCCAAGACAGTAGAGCAAGAGGTTGCCGAAAGTTCAGTTTCTGAAG
GGGAGCTGCCAAGCCATATGGATACAAAACATATAGAGCGAATACCGATGGCATCAGAGCAGGCTCAGAC
CGTAAGCCAACACTTACACGCAGGAAACCTCTCTGAACTGGGTAATTTAAACAATATGAACCGAGACTTA
GCTTTCCATTTGTTGAGAGAAGTCTCTGATTATTTTCGCCAGAGCGAACCGCATAGCCCAATTTCATTTT
TGTTAGAAAAAGCGATTCGATGGGGATATTTATCCTTACCTGAGTTGCTGCGAGAAATGATGTCGGAACA
AAACGGTGACGCTCTTAGTACGATTTTTAATGCCGCCGGATTGAATCATCTCGATCAGGTTTTGCTGCCG
GAGGTGAGTACTCCAACGGTGGGCATTGAAAGCCCCCAAACACCTCAAGCGAAGCCTTCCGTTTCGGATC
CGCGAAGTGTTGAAGAGCATGTATCTCAGACTTCCCCTGTAGATACCCAATCTAAGCAAGATCAAAAACC
ACAATCATCCGCTACGTCGGCTCTGAGTTGGTAA
 Primer design